BYKdb

Annotate results for A0A099WD98

A0A099WD98 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WD98
DOMAINcd49/225TSSASGEGKSVVIANLAAFFAQQDKRVLIIDGDLRRPTQHDIFQVENYYGFADILKEETN
VKKAIQKTAVENLDVLVSGMLPYNPAELLASFDFDAFFAELDAAYDFIFIDAPPAIVADT
PIIASKVDGVIVVVGLRTVKRSKLEQTIREVKTAGANVVGIICNKAKPTKKTAYYYK
SITEWalker A56/58GKS
SITEWalker A'76/83LIIDGDLR
SITEWalker B156/162IFIDAPP
SITE-96/-97YY
SITEY Cluster222/224YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMRKAKNKEDKKLTVFTQRNTQIAEQFRMIRTGLQFLAEKRSAKHFMVTSSASGEGKSVVIANLAAFFAQQDKRVLIIDG
                                                TSSASGEGKSVVIANLAAFFAQQDKRVLIIDG
                                                       GKS                 LIIDG
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRRPTQHDIFQVENYYGFADILKEETNVKKAIQKTAVENLDVLVSGMLPYNPAELLASFDFDAFFAELDAAYDFIFIDA
DLRRPTQHDIFQVENYYGFADILKEETNVKKAIQKTAVENLDVLVSGMLPYNPAELLASFDFDAFFAELDAAYDFIFIDA
DLR                                                                        IFIDA
       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
PPAIVADTPIIASKVDGVIVVVGLRTVKRSKLEQTIREVKTAGANVVGIICNKAKPTKKTAYYYK
PPAIVADTPIIASKVDGVIVVVGLRTVKRSKLEQTIREVKTAGANVVGIICNKAKPTKKTAYYYK
PP                                                           YYY 
© 1998-2019