BYKdb

Annotate results for A0A099WF84

A0A099WF84 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WF84
DOMAINcd51/231TSAEPDAGKSIMASNLAVVFAQQGKKTLLIDLDLRKPTQHRVFFSNNEIGLTGLLVKSEC
RTKAIQDTEIDKLQVLASGHIPPNPTEILNAPKLAELIETLREEYDQIILDAPPVLVASD
ARLIARLADGIIFIIKSGASEYKKIAKSIELLQQTQTKILGTVLNNPNAQAARMYYTYSD
K
SITEWalker A58/60GKS
SITEWalker A'78/85LLIDLDLR
SITEWalker B158/164IILDAPP
SITEY Cluster225/228YYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRNKNKQKKNNRKKLVTYFDPRSPISEEFTSVKTNIEFTTISQASQVLMITSAEPDAGKSIMASNLAVVFAQQGKKTLLI
                                                  TSAEPDAGKSIMASNLAVVFAQQGKKTLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLDLRKPTQHRVFFSNNEIGLTGLLVKSECRTKAIQDTEIDKLQVLASGHIPPNPTEILNAPKLAELIETLREEYDQIIL
DLDLRKPTQHRVFFSNNEIGLTGLLVKSECRTKAIQDTEIDKLQVLASGHIPPNPTEILNAPKLAELIETLREEYDQIIL
DLDLR                                                                        IIL
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAPPVLVASDARLIARLADGIIFIIKSGASEYKKIAKSIELLQQTQTKILGTVLNNPNAQAARMYYTYSDK
DAPPVLVASDARLIARLADGIIFIIKSGASEYKKIAKSIELLQQTQTKILGTVLNNPNAQAARMYYTYSDK
DAPP                                                            YYTY   
© 1998-2019