BYKdb

Annotate results for A0A099WGM2

A0A099WGM2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WGM2
DOMAINcd50/234TSPEPGAGKSFISMNLAISFAEQGNKVLLIDADLRRPTVHTTLRLSNELGLSNYLAGQGK
LEDCLQEITMHENLFVITSGIIPPNPAELLSSTKMKEFTKIVSDMFDIVIFDAPPVLPVV
DPLIIGNIVDGLILVLRSEHTDQSDAVQTLDKIKQSKIKMIGAVLNGRKNRGDSYKTVYY
TKNQK
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDADLR
SITEWalker B158/164VIFDAPP
SITEY Cluster224/229YKTVYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMRFKIKPKKKPNISIMQKESNSISSEQLRTIRTSIQFASTEKLSTMVVTSPEPGAGKSFISMNLAISFAEQGNKVLLID
                                                 TSPEPGAGKSFISMNLAISFAEQGNKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRRPTVHTTLRLSNELGLSNYLAGQGKLEDCLQEITMHENLFVITSGIIPPNPAELLSSTKMKEFTKIVSDMFDIVIF
ADLRRPTVHTTLRLSNELGLSNYLAGQGKLEDCLQEITMHENLFVITSGIIPPNPAELLSSTKMKEFTKIVSDMFDIVIF
ADLR                                                                         VIF
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
DAPPVLPVVDPLIIGNIVDGLILVLRSEHTDQSDAVQTLDKIKQSKIKMIGAVLNGRKNRGDSYKTVYYTKNQK
DAPPVLPVVDPLIIGNIVDGLILVLRSEHTDQSDAVQTLDKIKQSKIKMIGAVLNGRKNRGDSYKTVYYTKNQK
DAPP                                                           YKTVYY     
© 1998-2019