BYKdb

Annotate results for A0A099WHQ4

A0A099WHQ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WHQ4
DOMAINcd47/225TSPEPESGKSTVSANLAICYAKQGKKTLLIDADMRKPTSHRTFGIHYNVGLSHLLADSGI
ELEDVCHQTEIDNLMVLTSGALVPNPNELLASKKMEQLIQQFAEQFDQIIIDTPPILASS
DALVLTPYVEGAIVVLRSEKTLKDRAKTAVKLLQKTHVPIIGTVLNRVKNHSNSYYYYQ
SITEWalker A54/56GKS
SITEWalker A'74/81LLIDADMR
SITEWalker B155/161IIIDTPP
SITEY Cluster221/224YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKQDFSKRKLIAATNPSSPIAEQFKTLRAGIHFSSVDKDYQTILVTSPEPESGKSTVSANLAICYAKQGKKTLLIDADM
                                              TSPEPESGKSTVSANLAICYAKQGKKTLLIDADM
                                                     GKS                 LLIDADM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTSHRTFGIHYNVGLSHLLADSGIELEDVCHQTEIDNLMVLTSGALVPNPNELLASKKMEQLIQQFAEQFDQIIIDTP
RKPTSHRTFGIHYNVGLSHLLADSGIELEDVCHQTEIDNLMVLTSGALVPNPNELLASKKMEQLIQQFAEQFDQIIIDTP
R                                                                         IIIDTP
       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
PILASSDALVLTPYVEGAIVVLRSEKTLKDRAKTAVKLLQKTHVPIIGTVLNRVKNHSNSYYYYQ
PILASSDALVLTPYVEGAIVVLRSEKTLKDRAKTAVKLLQKTHVPIIGTVLNRVKNHSNSYYYYQ
P                                                           YYYY 
© 1998-2019