BYKdb

Annotate results for A0A099WIC1

A0A099WIC1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WIC1
DOMAINcd44/222TSTKPQEGKSTIIANLADVMGRQELKVLIIDADLRLPSQHYILGVDNSLGLTDILKEKAT
IETVIQNTSLFNVDIIAAGQSPNNPSELLSKTVLKDLLETVKKYYDYILIDAPPVIVADT
TIVAQKIDGVIMVAEENKTPKQKFQKALNTLKSTNTPILGIILNKTKQEKSSKYYYYNK
SITEWalker A51/53GKS
SITEWalker A'71/78LIIDADLR
SITEWalker B151/157ILIDAPP
SITE-147/-150YYDY
SITEY Cluster217/220YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKERSKLLIRHQKGSRIAEQFRIIRTNIEFISKKRALKTIMITSTKPQEGKSTIIANLADVMGRQELKVLIIDADLRLP
                                           TSTKPQEGKSTIIANLADVMGRQELKVLIIDADLRLP
                                                  GKS                 LIIDADLR  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQHYILGVDNSLGLTDILKEKATIETVIQNTSLFNVDIIAAGQSPNNPSELLSKTVLKDLLETVKKYYDYILIDAPPVIV
SQHYILGVDNSLGLTDILKEKATIETVIQNTSLFNVDIIAAGQSPNNPSELLSKTVLKDLLETVKKYYDYILIDAPPVIV
                                                                      ILIDAPP   
       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
ADTTIVAQKIDGVIMVAEENKTPKQKFQKALNTLKSTNTPILGIILNKTKQEKSSKYYYYNK
ADTTIVAQKIDGVIMVAEENKTPKQKFQKALNTLKSTNTPILGIILNKTKQEKSSKYYYYNK
                                                        YYYY  
© 1998-2019