BYKdb

Annotate results for A0A099WLQ3

A0A099WLQ3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A099WLQ3
DOMAINcd50/228TSSIPGEGKSTITSNIAMTFGQQNKKVLLIDGDMRRPTQDKLFRRLNNVGLSTLLANQHT
LEEAIQPIEEYNIDFLPSGPVPPNPAELLSSTKLEKLLEECKQKYDLIFIDSPPLIDIAD
GPILASKVDGTFLIVRAYKTYKAEIQKSVQILEQSNSKVMGYILNDVKKQGQGKNYYVY
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDGDMR
SITEWalker B157/163IFIDSPP
SITE-187/-190YKTY
SITEY Cluster225/228YYVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSLSRKKNKPPVNRLAQLGGNKSVNEQFRIIRTNIEFVSMGQNNVYLITSSIPGEGKSTITSNIAMTFGQQNKKVLLID
                                                 TSSIPGEGKSTITSNIAMTFGQQNKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDMRRPTQDKLFRRLNNVGLSTLLANQHTLEEAIQPIEEYNIDFLPSGPVPPNPAELLSSTKLEKLLEECKQKYDLIFID
GDMRRPTQDKLFRRLNNVGLSTLLANQHTLEEAIQPIEEYNIDFLPSGPVPPNPAELLSSTKLEKLLEECKQKYDLIFID
GDMR                                                                        IFID
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
SPPLIDIADGPILASKVDGTFLIVRAYKTYKAEIQKSVQILEQSNSKVMGYILNDVKKQGQGKNYYVY
SPPLIDIADGPILASKVDGTFLIVRAYKTYKAEIQKSVQILEQSNSKVMGYILNDVKKQGQGKNYYVY
SPP                                                             YYVY
© 1998-2019