BYKdb

Annotate results for A0A0A0B6L4

A0A0A0B6L4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A0B6L4
DOMAINtad1/135MEPSEYLSILRRNWLLLVLAAVLGFVGGYGYAQTVPPSYRAKASVFIAVPPGATVNEDVQ
GSTYVQNTVPSLARLAVQPVVLDEVIEDLDLGTTAGPLAKTVTVESPLDTSILEISVVSA
EPERAAAIANGIADQ
DOMAINcd267/456TSSLPGEGKSVTTINLAMAMAEGSSRILLVDADLRRPSVARMLGLEGAVGLTTVLIGDAS
LDEVVQPFGDGTLDVLASGQIPPNPSELLDSDAMAELLREAALRYDIVLLDSAPLLPVTD
AAVLARLTDGALLVVGCRKAHRHQVAEALSSLETVSARLLGIVLNQISSKESGAAYVYGS
VPGGDTRPTG
SITEWalker A274/276GKS
SITEWalker A'294/301LLVDADLR
SITEWalker B374/380VLLDSAP
SITEY Cluster442/444YVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEPSEYLSILRRNWLLLVLAAVLGFVGGYGYAQTVPPSYRAKASVFIAVPPGATVNEDVQGSTYVQNTVPSLARLAVQPV
MEPSEYLSILRRNWLLLVLAAVLGFVGGYGYAQTVPPSYRAKASVFIAVPPGATVNEDVQGSTYVQNTVPSLARLAVQPV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDEVIEDLDLGTTAGPLAKTVTVESPLDTSILEISVVSAEPERAAAIANGIADQLPESVATLMGDRDSDRPAIQITTTG
VLDEVIEDLDLGTTAGPLAKTVTVESPLDTSILEISVVSAEPERAAAIANGIADQ                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PATPPAFAFSPNTKLDAATGMALGLALGVAFLLGRRLIDTRVRSLRDLRRVTDAAVLSVVRWERRDTEDRLVVRDRPQSD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAEAFRRLRTNLRFLNLRGSGRTIVVTSSLPGEGKSVTTINLAMAMAEGSSRILLVDADLRRPSVARMLGLEGAVGLTTV
                          TSSLPGEGKSVTTINLAMAMAEGSSRILLVDADLRRPSVARMLGLEGAVGLTTV
                                 GKS                 LLVDADLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGDASLDEVVQPFGDGTLDVLASGQIPPNPSELLDSDAMAELLREAALRYDIVLLDSAPLLPVTDAAVLARLTDGALLV
LIGDASLDEVVQPFGDGTLDVLASGQIPPNPSELLDSDAMAELLREAALRYDIVLLDSAPLLPVTDAAVLARLTDGALLV
                                                     VLLDSAP                    
       410       420       430       440       450       460       470   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VGCRKAHRHQVAEALSSLETVSARLLGIVLNQISSKESGAAYVYGSVPGGDTRPTGRGRRGAQRARGAGETAR
VGCRKAHRHQVAEALSSLETVSARLLGIVLNQISSKESGAAYVYGSVPGGDTRPTG                 
                                         YVY                             
© 1998-2019