BYKdb

Annotate results for A0A0A0CCR1

A0A0A0CCR1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A0CCR1
DOMAINtad1/135MELRDYLAIVRKRWISIALITVLLTGAAVAVTLATTPVYTARAQVYVSVRTGETTTDLLQ
GSSFSQRQVKSYTDLASTPLVLTPVIEHLDLATTPDTLAESVSADSPLDTSLINIRASDP
DPQTASDIANAVAES
DOMAINcd266/454TSSLPTEGKSTVAVNLAITLSDAGSRVVIVDADLRRPSVAEYMGVEGSVGLTTVLIGKAS
IEDVVQPWGTGNLHVLPSGQVPPNPSEMVGSAAMAWLINELTKRYDLVIIDTPPLLPVTD
AAILARLVDGALVVTGANRLHRHELADAMGSLEAVGARVLGVVVNHLARKHGEGYSYHYY
GSDENAPRQ
SITEWalker A273/275GKS
SITEWalker A'293/300VIVDADLR
SITEWalker B373/379VIIDTPP
SITEY Cluster440/445YSYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYLAIVRKRWISIALITVLLTGAAVAVTLATTPVYTARAQVYVSVRTGETTTDLLQGSSFSQRQVKSYTDLASTPL
MELRDYLAIVRKRWISIALITVLLTGAAVAVTLATTPVYTARAQVYVSVRTGETTTDLLQGSSFSQRQVKSYTDLASTPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLTPVIEHLDLATTPDTLAESVSADSPLDTSLINIRASDPDPQTASDIANAVAESLAEQVTALEEPDEGPSPVEINTVRT
VLTPVIEHLDLATTPDTLAESVSADSPLDTSLINIRASDPDPQTASDIANAVAES                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASAPTEPSSPNLKLNVALGLLLGLAAGFGLAILREVLDTRVRTVDDVRSVTTASILTSMAHDEESVGKSLVVQTDPHSPR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAFRRLRTNLQFLDVAERLSAIVVTSSLPTEGKSTVAVNLAITLSDAGSRVVIVDADLRRPSVAEYMGVEGSVGLTTVL
                         TSSLPTEGKSTVAVNLAITLSDAGSRVVIVDADLRRPSVAEYMGVEGSVGLTTVL
                                GKS                 VIVDADLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGKASIEDVVQPWGTGNLHVLPSGQVPPNPSEMVGSAAMAWLINELTKRYDLVIIDTPPLLPVTDAAILARLVDGALVVT
IGKASIEDVVQPWGTGNLHVLPSGQVPPNPSEMVGSAAMAWLINELTKRYDLVIIDTPPLLPVTDAAILARLVDGALVVT
                                                    VIIDTPP                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GANRLHRHELADAMGSLEAVGARVLGVVVNHLARKHGEGYSYHYYGSDENAPRQRRGARRPAPKARSSRAAGHANAPVTR
GANRLHRHELADAMGSLEAVGARVLGVVVNHLARKHGEGYSYHYYGSDENAPRQ                          
                                       YSYHYY                                   
       490       500       510       520       530  
....:....|....:....|....:....|....:....|....:....|..
LTPPPSATPPRVTTRHTPEAAPQPQPTGSFDALLQTEPDEVRPGRWPGGPIA


© 1998-2019