BYKdb

Annotate results for A0A0A0DE45

A0A0A0DE45 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0DE45
DOMAINcd41/230TSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSVMSGVFKSKEKITGLTDYLAGKT
DLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYIIVDTPPIGLVI
DAAIIAQKCDASLLVTEAGAVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGI
YGAYGNYGNY
SITEWalker A48/50GKS
SITEWalker A'68/75ILIDADIR
SITEWalker B149/155IIVDTPP
SITE-145/-148YYDY
SITE-98/-100GKT
SITEY Cluster215/230YGSYGIYGAYGNYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRLELSRSRKASIEKTEEYYNALRTNIQLSGDNLKIIALTSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSVMS
                                        TSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSVMS
                                               GKS                 ILIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSKEKITGLTDYLAGKTDLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYIIVDTPPIGLVI
GVFKSKEKITGLTDYLAGKTDLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYIIVDTPPIGLVI
                                                                    IIVDTPP     
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
DAAIIAQKCDASLLVTEAGAVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGIYGAYGNYGNYGTKKEK
DAAIIAQKCDASLLVTEAGAVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGIYGAYGNYGNY      
                                                      YGSYGIYGAYGNYGNY      
© 1998-2019