BYKdb

Annotate results for A0A0A0E6N1

A0A0A0E6N1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0E6N1
DOMAINcd46/226SSSGPGEGKSTTAANLAVVFSQLGKKVLLVDADLRKPTVHRSFAVNNLFGFTTVLTKQAT
LANTVVETEEKDLFILTSGPIPPNPAELLSSKSMEQFMEEAKEQFDYVVFDTLPLLAVAD
PQIIANKVDGSILVVFSGKTEIDQVKKAKELLVNAQSKLVGVVLNHKEMKDNDYYYYYGA
K
SITE-183/-185GKT
SITEWalker A'73/80LLVDADLR
SITEWalker B153/159VVFDTLP
SITEY Cluster219/223YYYYY
SITEWalker A53/55GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKTTDPSRKLIASLDPKSPISEQYRTIRTNIQYSSVDEELKTIMVSSSGPGEGKSTTAANLAVVFSQLGKKVLLVDADLR
                                             SSSGPGEGKSTTAANLAVVFSQLGKKVLLVDADLR
                                                    GKS                 LLVDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTVHRSFAVNNLFGFTTVLTKQATLANTVVETEEKDLFILTSGPIPPNPAELLSSKSMEQFMEEAKEQFDYVVFDTLPL
KPTVHRSFAVNNLFGFTTVLTKQATLANTVVETEEKDLFILTSGPIPPNPAELLSSKSMEQFMEEAKEQFDYVVFDTLPL
                                                                        VVFDTLP 
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
LAVADPQIIANKVDGSILVVFSGKTEIDQVKKAKELLVNAQSKLVGVVLNHKEMKDNDYYYYYGAK
LAVADPQIIANKVDGSILVVFSGKTEIDQVKKAKELLVNAQSKLVGVVLNHKEMKDNDYYYYYGAK
                                                          YYYYY   
© 1998-2019