BYKdb

Annotate results for A0A0A0FHV8

A0A0A0FHV8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0FHV8
DOMAINcd34/223TGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSNAHGLSEYLAGKDE
LNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSD
AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYN
YYGYSYSEKE
SITEWalker A41/43GKT
SITEWalker A'61/68LFIDADLR
SITEWalker B141/147VIVDTPP
SITEY Cluster208/219YSYGYNYYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSN
                                 TGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSN
                                        GKT                 LFIDADLR            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRS
AHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRS
                                                            VIVDTPP             
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
VGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
VGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
                                               YSYGYNYYGYSY    
© 1998-2019