BYKdb

Annotate results for A0A0A0HJJ4

A0A0A0HJJ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0HJJ4
DOMAINcd138/322TSPTPDCGKSFVAANLAISLSRQSSVRSVLMDMDLRRPSLAHTLGQPDPGRMAGFLSGDI
PLQRFLTCPEENALNIGQTLAMGLNDRAEPYAAEILHAPETGEVLQDLYRRLAPDVVIFD
MPPALYYDDVLGFRPQFDGVLIVVGGGRTTAQHIRDVKARFGTDTPLLGVVMNRAEGESI
AKYGY
SITEWalker A145/147GKS
SITEWalker A'166/173VLMDMDLR
SITEWalker B254/260VIFDMPP
SITE-263/-264YY
SITEY Cluster320/322YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLKRHEEYMRRRAARRAEMEAEADDEVPQVVDTPEPEAPAQDEIAQEETALAAPPESLELSEPEPEPEPEPEPEPEPEP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPLLWPALRRVVLDPKHLAKHRLISATREDPAHVAFDVLRTKLLAALRTHGWHRVAITSPTPDCGKSFVAANLAISLSRQ
                                                         TSPTPDCGKSFVAANLAISLSRQ
                                                                GKS             
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSVRSVLMDMDLRRPSLAHTLGQPDPGRMAGFLSGDIPLQRFLTCPEENALNIGQTLAMGLNDRAEPYAAEILHAPETGE
SSVRSVLMDMDLRRPSLAHTLGQPDPGRMAGFLSGDIPLQRFLTCPEENALNIGQTLAMGLNDRAEPYAAEILHAPETGE
     VLMDMDLR                                                                   
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLQDLYRRLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTTAQHIRDVKARFGTDTPLLGVVMNRAEGESIAKY
VLQDLYRRLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTTAQHIRDVKARFGTDTPLLGVVMNRAEGESIAKY
             VIFDMPP                                                           Y
  
..
GY
GY
GY
© 1998-2019