BYKdb

Annotate results for A0A0A0I9D9

A0A0A0I9D9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0I9D9
DOMAINcd38/225TSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKFHISNEKGLSNYLVGEVS
FEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDA
QILSTIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYY
YYGDEDEK
SITEWalker A45/47GKS
SITEWalker A'65/72LLIDCDLR
SITEWalker B144/150IVIDTPP
SITE-105/-110YNENLY
SITEY Cluster211/219YGYSYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVEKEPKSIAAESYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
                                     TSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
                                            GKS                 LLIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HISNEKGLSNYLVGEVSFEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
HISNEKGLSNYLVGEVSFEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
                                                               IVIDTPP          
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEKSKKRRKSKK
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEK         
                                                  YGYSYYYYY               
© 1998-2019