BYKdb

Annotate results for A0A0A0JGH0

A0A0A0JGH0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0JGH0
DOMAINcd286/472TSGNAAEGKTTTVANLAASFAETGQRVLVLDADLRSPNTHTLFDVPQGAGISDYISDNED
TPLEALIRPTNVPAVRIITAGTRLTHPASLASRMGHLLAEVRELADVVIIDSAPLLAASD
VFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGARGRRADGYGHSYG
YGDTARP
SITEWalker A293/295GKT
SITEWalker A'313/320LVLDADLR
SITEWalker B393/399VIIDSAP
SITEY Cluster460/466YGHSYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLQDYIRIIRQRWIVIVICAAVAGLVTWFLTPANASSVKDAPSYTATATVLVSAATADEQVSVDRVVLYAKTGAIPTAA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKALEFEGDPAILASQVTITSDPSGAALTIAASDRDGAKAAETANAFAKQTVAFFAKPRPGVGRAVVTILQEATPIPDEI


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGGFVVPPSRPLRAALAALVGLLLGFALALVLQRVDSRLRTRDEVHAGLRLPIIAEVPRLKRSQKGERTITVAVDPLSPY


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDAYRAARTALMHTVSRQAPGEYMGRRAARPEPRPVVEGARLILVTSGNAAEGKTTTVANLAASFAETGQRVLVLDADLR
                                             TSGNAAEGKTTTVANLAASFAETGQRVLVLDADLR
                                                    GKT                 LVLDADLR
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPNTHTLFDVPQGAGISDYISDNEDTPLEALIRPTNVPAVRIITAGTRLTHPASLASRMGHLLAEVRELADVVIIDSAPL
SPNTHTLFDVPQGAGISDYISDNEDTPLEALIRPTNVPAVRIITAGTRLTHPASLASRMGHLLAEVRELADVVIIDSAPL
                                                                        VIIDSAP 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGARGRRADGYGHSYGYGDTARPQRDSPSPK
LAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGARGRRADGYGHSYGYGDTARP        
                                                           YGHSYGY              
       490       500       510       520       530 
....:....|....:....|....:....|....:....|....:....|.
MELDPRQQPSAPSVAVPQHASAPEVDRWSLPPRVDDPQDAAPSRRSRHSSH


© 1998-2019