BYKdb

Annotate results for A0A0A0JTY0

A0A0A0JTY0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0JTY0
DOMAINcd293/482TSAHAAEGKTTSVANLAASFAETGQRVLVLDADLRSPDVHNVFDVPQGAGISDYLSDVSG
DASLASLMRPTSVPGVRIMSAGSSLAHPAALASRMSHLLDEARGMADVVLIDTAPLLEAS
DVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAPTKRADAYGYGY
GDDRMSKRKA
SITEWalker A300/302GKT
SITEWalker A'320/327LVLDADLR
SITEWalker B401/407VLIDTAP
SITEY Cluster468/472YGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLQDYFKVFRHRWIIIVICALVAGAITWFITPASSDTTKKVGSYTATATMLVTAKASSAATAVAPNLDRVALYLKTGEV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKRAAKKVGYEGDPAVLASGLTVVTDPAAQAITVAATASDGKQAAAVANAFANETINYIKEKPRAGVENARLEVLQTATP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPTAGSDGGFVIPPGRGPRTAIATLLGVLVGLGLALLLDRLDSRLRTRSEIHNALQMPIIAEVPRLKRAQRSRASIAVAT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPLSIYSDGYRAARTALVHTTGQVMPGDYTPRRAASEVPEKQAATGARLIVVTSAHAAEGKTTSVANLAASFAETGQRVL
                                                    TSAHAAEGKTTSVANLAASFAETGQRVL
                                                           GKT                 L
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDADLRSPDVHNVFDVPQGAGISDYLSDVSGDASLASLMRPTSVPGVRIMSAGSSLAHPAALASRMSHLLDEARGMADV
VLDADLRSPDVHNVFDVPQGAGISDYLSDVSGDASLASLMRPTSVPGVRIMSAGSSLAHPAALASRMSHLLDEARGMADV
VLDADLR                                                                         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAPTKRADAYGYGYGDDRMSKR
VLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAPTKRADAYGYGYGDDRMSKR
VLIDTAP                                                            YGYGY        
       490       500       510       520      
....:....|....:....|....:....|....:....|....:.
KAKRARKGARSRQSGPVGPPTGHMGDFFDDAEQPESRRSRRTSSSA
KA                                            

© 1998-2019