BYKdb

Annotate results for A0A0A0JXF2

A0A0A0JXF2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0JXF2
DOMAINcd287/474TSAHAAEGKTTSVANLAASFAETGQKVLVVDADLRSPDVHNVFDVPQGAGISDYLSDPGG
TSLETVVRPTSVPGVRIITAGTVLTHPASLASRMGGLLEEAREMADVVLIDTAPLLEASD
VFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAKARRGDAYGYGYG
ETRKAKKK
SITEWalker A294/296GKT
SITEWalker A'314/321LVVDADLR
SITEWalker B394/400VLIDTAP
SITEY Cluster461/465YGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLQDYIKVFRHRWIVIVLCAVIAAGVTWLVTPASADTTKKVGSYTATATILVGSTDPERTGNMGRIPLYMTTGEIPRRA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVVGYEGDPARLAAGLTVTPDNAAEALTVSATASDGEEAAAVANAFATETVKFFKETSPPGAENTTLTILQPATPIPST


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANDGGFVVPPGRGPRTAIATLLGLLVGMGLALLLDRLDSRLRSRSEIGDALSMPIIAEVPRLKRSQRNRNSIAVVEDPLN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYSDAYRAARTALSHTAGQVMPSDYTPRRSTVEPRRSASSARLVLITSAHAAEGKTTSVANLAASFAETGQKVLVVDADL
                                              TSAHAAEGKTTSVANLAASFAETGQKVLVVDADL
                                                     GKT                 LVVDADL
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSPDVHNVFDVPQGAGISDYLSDPGGTSLETVVRPTSVPGVRIITAGTVLTHPASLASRMGGLLEEAREMADVVLIDTAP
RSPDVHNVFDVPQGAGISDYLSDPGGTSLETVVRPTSVPGVRIITAGTVLTHPASLASRMGGLLEEAREMADVVLIDTAP
R                                                                        VLIDTAP
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAKARRGDAYGYGYGETRKAKKKVKRERK
LLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAKARRGDAYGYGYGETRKAKKK      
                                                            YGYGY               
       490       500       510       520       530       540       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
LAEKRGPVAPATPSTSSRPTTGPAEETRSRDAVGTADPTTTVDPVLGVDDDDVEPDSRRTRRRASSL


© 1998-2019