BYKdb

Annotate results for A0A0A0Y931

A0A0A0Y931 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A0Y931
DOMAINcd41/230TSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMSGAFKSDDRYEGLSSYLSGNA
ELSSVISRTDVPNLMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILHKVDQQLGSYGAYGS
YGDYGKTKKS
SITE-225/-227GKT
SITEWalker A'68/75LLIDADVR
SITEWalker B149/155IIIDTPP
SITE-89/-95YEGLSSY
SITEY Cluster215/224YGAYGSYGDY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQLNLVRSKREHYQHAEEYYNSIRTNIQFSGRDYKAIVLTSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
                                        TSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
                                               GKS                 LLIDADVR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
                                                                    IIIDTPP     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILHKVDQQLGSYGAYGSYGDYGKTKKSSKSKKHSRK
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILHKVDQQLGSYGAYGSYGDYGKTKKS         
                                                      YGAYGSYGDY               
© 1998-2019