BYKdb

Annotate results for A0A0A1D2Z9

A0A0A1D2Z9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A1D2Z9
DOMAINtad13/149KSLDVRDYVRVFRQHGLGVIALALIGILCSAGWLFLQKPIYAANSIGYVSIPGGDNMGSA
LAGDNLAKSKATSYASFAGSRPVAESVINTLGLNIAPDVLLKQISVTAAKDTAQIKIAAS
AESALEAQQLANAWVVA
DOMAINcd295/484TSSIPGEGKSTIAANLAVTIAATGQRVVLIDGDLRRPVVAEFFGMASGGGLTDILSGQAT
LDDVLQVYRPVPALAVLGAGRIPPNPSELLGSQAMKRLLERLSESAVVLIDAPPLLPVTD
AAILARSTDGALVVAGAGKTTIDELEKAVATLAKVQAPLLGAVLNRVPTTGGQAAGYGYY
GKSYHYHQSV
SITE-432/-434GKT
SITEWalker A'322/329VLIDGDLR
SITEWalker B402/408VLIDAPP
SITEY Cluster471/480YGYYGKSYHY
SITE-475/-477GKS
SITEWalker A302/304GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLEDEQLGNAEKSLDVRDYVRVFRQHGLGVIALALIGILCSAGWLFLQKPIYAANSIGYVSIPGGDNMGSALAGDNLAK
            KSLDVRDYVRVFRQHGLGVIALALIGILCSAGWLFLQKPIYAANSIGYVSIPGGDNMGSALAGDNLAK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKATSYASFAGSRPVAESVINTLGLNIAPDVLLKQISVTAAKDTAQIKIAASAESALEAQQLANAWVVALAEQVGILESA
SKATSYASFAGSRPVAESVINTLGLNIAPDVLLKQISVTAAKDTAQIKIAASAESALEAQQLANAWVVA           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNPLDPAAPPVDSIIKIVPLGDAPLPQSPVSPNKKMTLIVGALAGLIIGVGYALVRNHLDRRIRSVEMVEKAIGTAVVGT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPVDDRLRNGRHVVESGVIDHGNTEGYAMSEALRELRTNLHYMNVDNPPRVIVITSSIPGEGKSTIAANLAVTIAATGQR
                                                      TSSIPGEGKSTIAANLAVTIAATGQR
                                                             GKS                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLIDGDLRRPVVAEFFGMASGGGLTDILSGQATLDDVLQVYRPVPALAVLGAGRIPPNPSELLGSQAMKRLLERLSESA
VVLIDGDLRRPVVAEFFGMASGGGLTDILSGQATLDDVLQVYRPVPALAVLGAGRIPPNPSELLGSQAMKRLLERLSESA
 VLIDGDLR                                                                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLIDAPPLLPVTDAAILARSTDGALVVAGAGKTTIDELEKAVATLAKVQAPLLGAVLNRVPTTGGQAAGYGYYGKSYHY
VVLIDAPPLLPVTDAAILARSTDGALVVAGAGKTTIDELEKAVATLAKVQAPLLGAVLNRVPTTGGQAAGYGYYGKSYHY
 VLIDAPP                                                              YGYYGKSYHY
       490       500       510       520       530       540 
....:....|....:....|....:....|....:....|....:....|....:....|.
HQSVKGAKARYKRTRNSAPAAPPVAEPAAANEADVQSREAEFEQLLSPSTDNATRRMTRSR
HQSV                                                         

© 1998-2019