BYKdb

Annotate results for A0A0A1DU08

A0A0A1DU08 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A1DU08
DOMAINtad1/120MSIVAIILIALGVSAAITFTRTPMYESKTQIFLTVDVRDTTDAYAALLFASNRAASYATV
VKSTELAEIVKDQLNLKESAEVLASRVDAEVVDTTSLIQITVKAKNPRDAETIADRTTKE
DOMAINcd254/442TSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAVGLTTALVGKTE
IHDAIQVHEASGLHVLASGAKPPNPTEILQSKITHDLILRLRSSYDMVIIDAPPLLPVAD
ASVLAKLADGVIIVVRHARTTKDQVNEAINRLNHVGARLYGVVVNMVAKRAIGSYYYYYY
EETSPSGRG
SITE-310/-312GKT
SITEWalker A'281/288LIIDADLR
SITEWalker B361/367VIIDAPP
SITEY Cluster428/433YYYYYY
SITEWalker A261/263GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSIVAIILIALGVSAAITFTRTPMYESKTQIFLTVDVRDTTDAYAALLFASNRAASYATVVKSTELAEIVKDQLNLKESA
MSIVAIILIALGVSAAITFTRTPMYESKTQIFLTVDVRDTTDAYAALLFASNRAASYATVVKSTELAEIVKDQLNLKESA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVLASRVDAEVVDTTSLIQITVKAKNPRDAETIADRTTKEFIKYVGGLETPGGDLGGQSQILAQITDNASYNPNQVSPDV
EVLASRVDAEVVDTTSLIQITVKAKNPRDAETIADRTTKE                                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALNLVVAGLIGILLGIGLAIARELLDRTIRTADHVAELTESPVLASIGFDNDIRSAPLLTDLGGFAARTEAFRLLRTNLQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIDLDHQPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAVGLTTALVGKTEIHDAIQV
             TSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAVGLTTALVGKTEIHDAIQV
                    GKT                 LIIDADLR                                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HEASGLHVLASGAKPPNPTEILQSKITHDLILRLRSSYDMVIIDAPPLLPVADASVLAKLADGVIIVVRHARTTKDQVNE
HEASGLHVLASGAKPPNPTEILQSKITHDLILRLRSSYDMVIIDAPPLLPVADASVLAKLADGVIIVVRHARTTKDQVNE
                                        VIIDAPP                                 
       410       420       430       440       450        
....:....|....:....|....:....|....:....|....:....|....:...
AINRLNHVGARLYGVVVNMVAKRAIGSYYYYYYEETSPSGRGDKSGSSKSNGSGRRRA
AINRLNHVGARLYGVVVNMVAKRAIGSYYYYYYEETSPSGRG                
                           YYYYYY                         
© 1998-2019