BYKdb

Annotate results for A0A0A1FKJ2

A0A0A1FKJ2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A1FKJ2
DOMAINtad17/273NEIDLAACLDLLFDHRWLIVSITMAVTLLGAIYAFSVKPTYSADILVQVEDGPNSSKSLL
GGVSALLDVKAAANSEMELLRSRLVVSRAVDTLQLYVDARPKHFPLFGAWWSGRWPQLSN
PGLFGYGGYAWGAERIEVALFNVSEALQNRNFVLTVEPSGQFLLKDDDADINLQGKVGTP
LKANNSHGEIELTVAKIVAKPGTQFLLTRKSRLDTIRKLQGAMLISEKGKQSGIIGITLT
GENPRLTSNILNEIGHE
DOMAINcd550/738TGPTPGLGKSFISANVAVVLAAAGKRVLLVDVDMRKGQLHQYFGFARENGLSELVAGANT
VEQSLRRDVIENLDFLSTGNLPPNPAELLMHENFAKLLQSLAPDYDYVMLDAPPVLAVSD
SLIVARQAGAIYMVVRANVSTMGEIKESLKRLQQAGMSNKGILFNGLRMRPGRYGHGSKY
GKYRYTEYA
SITEWalker A557/559GKS
SITEWalker A'577/584LLVDVDMR
SITEWalker B657/663VMLDAPP
SITE-654/-656YDY
SITEY Cluster723/739YGHGSKYGKYRYTEYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNAPIQAVSSGEPQHENEIDLAACLDLLFDHRWLIVSITMAVTLLGAIYAFSVKPTYSADILVQVEDGPNSSKSLLGGVS
                NEIDLAACLDLLFDHRWLIVSITMAVTLLGAIYAFSVKPTYSADILVQVEDGPNSSKSLLGGVS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLDVKAAANSEMELLRSRLVVSRAVDTLQLYVDARPKHFPLFGAWWSGRWPQLSNPGLFGYGGYAWGAERIEVALFNVS
ALLDVKAAANSEMELLRSRLVVSRAVDTLQLYVDARPKHFPLFGAWWSGRWPQLSNPGLFGYGGYAWGAERIEVALFNVS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EALQNRNFVLTVEPSGQFLLKDDDADINLQGKVGTPLKANNSHGEIELTVAKIVAKPGTQFLLTRKSRLDTIRKLQGAML
EALQNRNFVLTVEPSGQFLLKDDDADINLQGKVGTPLKANNSHGEIELTVAKIVAKPGTQFLLTRKSRLDTIRKLQGAML

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISEKGKQSGIIGITLTGENPRLTSNILNEIGHEYVRQNVERISEEYEKSLVFLNEQLPEIKRELEQSESKYNQFRNMHGT
ISEKGKQSGIIGITLTGENPRLTSNILNEIGHE                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDLGEEAKLALQQSVAAQTKLVELRQKREELLVRFTSDHPAVVGLDRQMKDISIEMRSIGEQIKGLPKLEQDTLRLTRDI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVNTDLYSALLKTAQQTRVAKSGKVGNVRLVDAAVVPEHSVAPRRGVIIALSVFLGLVLGVMCAALRKMLYGGIDSPHEL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQALGLSVYATIPHSKKQEELYVEIVAKASKNLLLAQVDPTDLAVESLRSFRTALQFSMLDAASNILLITGPTPGLGKSF
                                                                     TGPTPGLGKSF
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISANVAVVLAAAGKRVLLVDVDMRKGQLHQYFGFARENGLSELVAGANTVEQSLRRDVIENLDFLSTGNLPPNPAELLMH
ISANVAVVLAAAGKRVLLVDVDMRKGQLHQYFGFARENGLSELVAGANTVEQSLRRDVIENLDFLSTGNLPPNPAELLMH
                LLVDVDMR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENFAKLLQSLAPDYDYVMLDAPPVLAVSDSLIVARQAGAIYMVVRANVSTMGEIKESLKRLQQAGMSNKGILFNGLRMRP
ENFAKLLQSLAPDYDYVMLDAPPVLAVSDSLIVARQAGAIYMVVRANVSTMGEIKESLKRLQQAGMSNKGILFNGLRMRP
                VMLDAPP                                                         
       730         
....:....|....:....
GRYGHGSKYGKYRYTEYAY
GRYGHGSKYGKYRYTEYA 
  YGHGSKYGKYRYTEYAY

© 1998-2019