BYKdb

Annotate results for A0A0A1GPZ1

A0A0A1GPZ1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A1GPZ1
DOMAINtad5/148NGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGA
SSNAVELSSGANYINSQIQTYPQLIKTESVLQPVIDDLGLDTTVKGLAASVTASNPDGTM
LVDISVNDPDPKQASSIANSVAEN
DOMAINcd283/471TSAGPSEGKTTLSVNLATAFAENGSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVS
SHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDTAPMQVAND
AAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGVAMNYGETEKPQKGGYYYY
GDESDDNGR
SITEWalker A290/292GKT
SITEWalker A'310/317LLIDADVR
SITEWalker B390/396VIIDTAP
SITE-387/-389YDY
SITEY Cluster459/462YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAVELSSGANYINS
    NGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAVELSSGANYINS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIQTYPQLIKTESVLQPVIDDLGLDTTVKGLAASVTASNPDGTMLVDISVNDPDPKQASSIANSVAENLRKQVTSTIYSD
QIQTYPQLIKTESVLQPVIDDLGLDTTVKGLAASVTASNPDGTMLVDISVNDPDPKQASSIANSVAEN            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGDKIISPVNLTVVQQAYAPTSPSSPNVKLNLAAGLGIGVILGIVVAFIKDLLDTRVRRDSDVTTVIDAPVLGSLSRNEA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSAGPSEGKTTLSVNLATAFAENGSKVLLIDADVRNPS
                                          TSAGPSEGKTTLSVNLATAFAENGSKVLLIDADVRNPS
                                                 GKT                 LLIDADVR   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDTAPMQVA
VSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDTAPMQVA
                                                                     VIIDTAP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGVAMNYGETEKPQKGGYYYYGDESDDNGRKRQIQHKKS
NDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGVAMNYGETEKPQKGGYYYYGDESDDNGR         
                                                          YYYY                  
      
....:.
EKTKKD


© 1998-2019