BYKdb

Annotate results for A0A0A1GUU8

A0A0A1GUU8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A1GUU8
DOMAINcd57/243TSSNVSEGKSTVSANTAVTWAQQGKRVLFIDADLRRPTLHTTFGLNNTQGLSTILTQSLD
FHDHVNDSGIENLTVITSGPVPPNPAELLNSKRMKELLAQVEQEYDVVMLDVPPLLSVTD
TQVLAASVDGVILVVRQGVAQQAAVKRSVELLEMVHAKLLGYVLNDVAPKNGYGYGYGYG
YGYGYEQ
SITEWalker A64/66GKS
SITEWalker A'84/91LFIDADLR
SITEWalker B164/170VMLDVPP
SITEY Cluster229/241YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFSRTKKLSTDTIDNGVKLIAAAKPKDVISEQFRTIRTNIDFSSVDKQLKTLLFTSSNVSEGKSTVSANTAVTWAQQG
                                                        TSSNVSEGKSTVSANTAVTWAQQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLFIDADLRRPTLHTTFGLNNTQGLSTILTQSLDFHDHVNDSGIENLTVITSGPVPPNPAELLNSKRMKELLAQVEQE
KRVLFIDADLRRPTLHTTFGLNNTQGLSTILTQSLDFHDHVNDSGIENLTVITSGPVPPNPAELLNSKRMKELLAQVEQE
   LFIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDVVMLDVPPLLSVTDTQVLAASVDGVILVVRQGVAQQAAVKRSVELLEMVHAKLLGYVLNDVAPKNGYGYGYGYGYGYG
YDVVMLDVPPLLSVTDTQVLAASVDGVILVVRQGVAQQAAVKRSVELLEMVHAKLLGYVLNDVAPKNGYGYGYGYGYGYG
   VMLDVPP                                                          YGYGYGYGYGYG
   
...
YEQ
YEQ
Y  
© 1998-2019