BYKdb

Annotate results for A0A0A2B4S6

A0A0A2B4S6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A2B4S6
DOMAINcd478/675SSCIPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSD
NYKKYIQSVPTQDNFDVITSGSIPPDPTRLLGSDSMKKFIETIRSENKYDYVILDTSPIL
SISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKTNRPLIGFVSNQIKKPKTFSKN
RYYGYSNYSNNYGYNSNY
SITEWalker A485/487GKS
SITEWalker A'505/512LLIDTDLR
SITEWalker B589/595VILDTSP
SITE-539/-588YKKYIQSVPTQDNFDVITSGSIPPDPTRLLGSDSMKKFIETIRSENKYDY
SITEY Cluster659/679YYGYSNYSNNYGYNSNYISYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLISDPLNNNKNNSANSIGGVFEQLALNSTDNDLPTLIELLKSPILLNPISKDYGIPFNKFSKSLKISTPGGLRTQSMAQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQSPKLEGKNKQVQKELSDFRERNQLIEPTVEGQ


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELKTRLDYLENELDNIKNERVKLNNLLNSIENGSLTAYGFKQAITTDLNLNERIPTEGVSFINLDLELLDQYILVKQKLA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IARTKYLEDSEIVKGLKYRVEQIEPTLKSNQISALISAREIIDKNIQNAKIKIKSLKEKFEKQPKLISEYKTLQQKALLA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPVPVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKEN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNLPLLAELPYIESFVNLRENNESIFNVEDKLNATKNEKSSESYLGYQRFFYQEAFRGMYTSIKFINTQNSLKILSISSC
                                                                             SSC

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSI
IPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSI
    GKS                 LLIDTDLR                                                
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPDPTRLLGSDSMKKFIETIRSENKYDYVILDTSPILSISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKTNRPL
PPDPTRLLGSDSMKKFIETIRSENKYDYVILDTSPILSISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKTNRPL
                            VILDTSP                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGFVSNQIKKPKTFSKNRYYGYSNYSNNYGYNSNYISYYADNKIRDKFTKRNLTFENSKDNFLISKIKKFRNKVLDFISW
IGFVSNQIKKPKTFSKNRYYGYSNYSNNYGYNSNY                                             
                  YYGYSNYSNNYGYNSNYISYY                                         
   
...
LDR


© 1998-2019