BYKdb

Annotate results for A0A0A2DUD9

A0A0A2DUD9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A2DUD9
DOMAINtad20/267NFFSLQDLWRLVCIRWYVIAISILLALGVAVLYILRTPPVYKRTASVMIKADDKGKSLSN
DMSSAFSELGLFQSNTNVNNELLSMKSPMLMEEVVRRLELWTSYEAPGAFHDHLLYGTNL
PLNLRFTDLSEQESAECILSQLPSGELQLHSFVLNGEKTEVQDPVTLVLGKATETPLGKV
LVNKNQGDDLDLVNGLIIKRSSLYDAVENLGKNLTVNLADEKSTILSLSLLDRSQERADA
ILNTLVAT
DOMAINcd619/807TSINPNSGKTFVALNLAASLAANGRRVLLIDLDMRVATLSDFVGRAPWGVSSLLTEATDD
YRELIISTQVAGLDALPVGIIPPNPTELLSQPKLGDLLVQFRKEYDYIVIDCPPVDLVAD
AALINEHTDLTIFIARAGMLDKRVLPVIDSYYKERKLRNMVLLLNGTDLSASYGYGYGYG
YGYGYGYHR
SITEWalker A626/628GKT
SITEWalker A'646/653LLIDLDMR
SITEWalker B726/732IVIDCPP
SITE-723/-725YDY
SITEY Cluster769/805YYKERKLRNMVLLLNGTDLSASYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIQNTTTVVEKPAAEGQQENFFSLQDLWRLVCIRWYVIAISILLALGVAVLYILRTPPVYKRTASVMIKADDKGKSLSND
                   NFFSLQDLWRLVCIRWYVIAISILLALGVAVLYILRTPPVYKRTASVMIKADDKGKSLSND

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSAFSELGLFQSNTNVNNELLSMKSPMLMEEVVRRLELWTSYEAPGAFHDHLLYGTNLPLNLRFTDLSEQESAECILSQ
MSSAFSELGLFQSNTNVNNELLSMKSPMLMEEVVRRLELWTSYEAPGAFHDHLLYGTNLPLNLRFTDLSEQESAECILSQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPSGELQLHSFVLNGEKTEVQDPVTLVLGKATETPLGKVLVNKNQGDDLDLVNGLIIKRSSLYDAVENLGKNLTVNLADE
LPSGELQLHSFVLNGEKTEVQDPVTLVLGKATETPLGKVLVNKNQGDDLDLVNGLIIKRSSLYDAVENLGKNLTVNLADE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSTILSLSLLDRSQERADAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEVDKNITKYKSQHLLPDVQTA
KSTILSLSLLDRSQERADAILNTLVAT                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLFLNQAAQVDNQIVELRSREYMARQVRNLLKNLDKSRLLPVNSFVNNPSLEQQIGEFNDLLLKRNNLVKNSSESNPLV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDLDANLNDLKSVIVASLDNQLLAIETQLMSLRSSERKNAGRIAASPEQANYLIAEGRQQTVKEALYLFLLQKREENQLS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAFTANNTRLISAPTGSPQPAFPQKRNILLVALALGIIVPVAFLYLKETLDTSIRSRRDLDNMQIPFIGEIPSFVRVKRG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YRAQIKKLLGIGKPPKKEIRLVVEHNNRNVINEAFRLVRTNIEMMLGRKNEQGRVLSLTSINPNSGKTFVALNLAASLAA
                                                          TSINPNSGKTFVALNLAASLAA
                                                                 GKT            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGRRVLLIDLDMRVATLSDFVGRAPWGVSSLLTEATDDYRELIISTQVAGLDALPVGIIPPNPTELLSQPKLGDLLVQFR
NGRRVLLIDLDMRVATLSDFVGRAPWGVSSLLTEATDDYRELIISTQVAGLDALPVGIIPPNPTELLSQPKLGDLLVQFR
     LLIDLDMR                                                                   
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEYDYIVIDCPPVDLVADAALINEHTDLTIFIARAGMLDKRVLPVIDSYYKERKLRNMVLLLNGTDLSASYGYGYGYGYG
KEYDYIVIDCPPVDLVADAALINEHTDLTIFIARAGMLDKRVLPVIDSYYKERKLRNMVLLLNGTDLSASYGYGYGYGYG
     IVIDCPP                                    YYKERKLRNMVLLLNGTDLSASYGYGYGYGYG
        
....:...
YGYGYHRE
YGYGYHR 
YGYGY   

© 1998-2019