BYKdb

Annotate results for A0A0A2EYC8

A0A0A2EYC8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A2EYC8
DOMAINtad19/257SSFNLMEWVMRFLKYWYLFAIGVVIALTIAYYQNRSFVPIYNSSLRLLLKQESGSFLSMQ
NFNSGFSRQDQTNIENQILLLQSQDLIGRTIDSLPNFKIDFYRKLKFKNRPMYGRSPIDI
EIISTPDAGFWQYYLYQKQNDNEFTIKIFDNEDVELETVKGRYNEPVGCKYFLIKVTKNS
NYHSANSVNFVFRNRDNLVMEFASKLQINLLPNTSVLNISVASDNPIRDVDFLSKHAKS
DOMAINcd588/778SSTESGDGKTYISLNLAGVFALQKKKVLLIDFDIRKPNLTRNLGDIIKTKSGFVNYMIGD
CTIEEAIESTPYGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYDYVVIDSSPLGLVA
DAYALFSTVDIKLLIVRSLKTNKVEFTDLAKRLYADNVEDIYVILNDVDKSKVGYGYGYS
KYKKMGNYYVT
SITEWalker A595/597GKT
SITEWalker A'615/622LLIDFDIR
SITEWalker B696/702VVIDSSP
SITE-693/-695YDY
SITEY Cluster762/776YGYGYSKYKKMGNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENTNNIPNIQTFSEEEASSFNLMEWVMRFLKYWYLFAIGVVIALTIAYYQNRSFVPIYNSSLRLLLKQESGSFLSMQNF
                  SSFNLMEWVMRFLKYWYLFAIGVVIALTIAYYQNRSFVPIYNSSLRLLLKQESGSFLSMQNF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSGFSRQDQTNIENQILLLQSQDLIGRTIDSLPNFKIDFYRKLKFKNRPMYGRSPIDIEIISTPDAGFWQYYLYQKQNDN
NSGFSRQDQTNIENQILLLQSQDLIGRTIDSLPNFKIDFYRKLKFKNRPMYGRSPIDIEIISTPDAGFWQYYLYQKQNDN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFTIKIFDNEDVELETVKGRYNEPVGCKYFLIKVTKNSNYHSANSVNFVFRNRDNLVMEFASKLQINLLPNTSVLNISVA
EFTIKIFDNEDVELETVKGRYNEPVGCKYFLIKVTKNSNYHSANSVNFVFRNRDNLVMEFASKLQINLLPNTSVLNISVA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVISDSLSRSESNLNSFKIANKMYGQNNSILLTNKMEAL
SDNPIRDVDFLSKHAKS                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEQGKIIKLRDEYFKYLRNYLKNNIDSESLASPTTIGIQEPRLIALVDKYNELQIKLLDLGVKNPQYDIVFNQISQTKAQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNELISSVSDIYKIESDAYQKDLNELNNLLIAAPNKELRMLDYERRYKINDSYYTFLLQKRSEAQIRKASNSPDNAVMQK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARTMSLINAKEKQNKYIVFLLIGLAVPAALIILKELLNNAIRTEKDIEKAIKNKFQIIGTVRHTKHKADEKVIAAKYPNS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YFVEQLRVIRTKIELILKRKERITMLVSSTESGDGKTYISLNLAGVFALQKKKVLLIDFDIRKPNLTRNLGDIIKTKSGF
                           SSTESGDGKTYISLNLAGVFALQKKKVLLIDFDIRKPNLTRNLGDIIKTKSGF
                                  GKT                 LLIDFDIR                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNYMIGDCTIEEAIESTPYGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYDYVVIDSSPLGLVADAYALFSTVDIKL
VNYMIGDCTIEEAIESTPYGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYDYVVIDSSPLGLVADAYALFSTVDIKL
                                                       VVIDSSP                  
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIVRSLKTNKVEFTDLAKRLYADNVEDIYVILNDVDKSKVGYGYGYSKYKKMGNYYVTEEFEQDDISMLEKIIDKIGEKT
LIVRSLKTNKVEFTDLAKRLYADNVEDIYVILNDVDKSKVGYGYGYSKYKKMGNYYVT                      
                                         YGYGYSKYKKMGNYY                        
       810   
....:....|...
KRIRNIHSSRLFK


© 1998-2019