BYKdb

Annotate results for A0A0A2F2N5

A0A0A2F2N5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A2F2N5
DOMAINcd584/774VSFGANAGKTFTTYNLARSLIFADKKVVIVDLDLRKGMMSKRLEMSGRGMTNYLSDDSIK
IEDVLRQDKNCPSLHVIPIGSSAPNPAELLMSERLDALMDELSARYDYVLIDGVPFGIVA
DATIVNRVVDLTLFILRSGTVDRRVLPDLQLLYDEKILNNMAIVLNGISSQNKGYGYGYG
YGYGYGYGYGY
SITEWalker A591/593GKT
SITEWalker A'611/618VIVDLDLR
SITEWalker B692/698VLIDGVP
SITE-689/-691YDY
SITEY Cluster758/776YGYGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPQSSSKQTKSAGTVVADINLIDLFFYLLGYWKWFLLSILLCTGYMYYKSAKQAYTYESVVTVIVRDPAQRTSIDLDLV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRRSRVNIENERLQLRSRVVIANAIKAINGHVHYGIIDGLRPIELYKSAPIQVTFADSLDQYHQFEVTYKDASSIVLSRE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGETKQVQLGEEVTYEKSRLIVVPSKGYNEPWPNKAIKITRLPVKDLAASYQGRLFIGQPENRATVLSLTLTDNSKQRAT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLSEELDALASNIDSFQRANNFIAPEVVAGAYTSRAQTGHEASFEI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQKRLARYFLDFINNPSKRSEYLPQNIGLNNAALETAITAYNQVKPEYDRWLATTGGMEDHPMVQKYAKAMEQTRMSIS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTLEGYIKSLDLQLREIEIRNRQGLAEMMAVPNKQRQWLDIERQQRMKEALYTQLLSKREENTLAQTAQSNNAYVMDFDT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSNSPISPNTTRTLLISFAIGLFIPTAFFLLKLLADTKVRTRKDVLERVSIPYLGDIPQSDTNLFVAVEPQGSDAITEAF


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVLRTNMGFMKKYGRTSGQRIMCVSFGANAGKTFTTYNLARSLIFADKKVVIVDLDLRKGMMSKRLEMSGRGMTNYLSDD
                       VSFGANAGKTFTTYNLARSLIFADKKVVIVDLDLRKGMMSKRLEMSGRGMTNYLSDD
                              GKT                 VIVDLDLR                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIKIEDVLRQDKNCPSLHVIPIGSSAPNPAELLMSERLDALMDELSARYDYVLIDGVPFGIVADATIVNRVVDLTLFILR
SIKIEDVLRQDKNCPSLHVIPIGSSAPNPAELLMSERLDALMDELSARYDYVLIDGVPFGIVADATIVNRVVDLTLFILR
                                                   VLIDGVP                      
       730       740       750       760       770       780       790  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
SGTVDRRVLPDLQLLYDEKILNNMAIVLNGISSQNKGYGYGYGYGYGYGYGYGYGYGNKKERSGIFSRFRKS
SGTVDRRVLPDLQLLYDEKILNNMAIVLNGISSQNKGYGYGYGYGYGYGYGYGY                  
                                     YGYGYGYGYGYGYGYGYGY                

© 1998-2019