BYKdb

Annotate results for A0A0A2F501

A0A0A2F501 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A2F501
DOMAINtad19/269SFLSLRDLWAMCWARKFWFVLSLGLFLGGAILYILITPPVYKRTATLLIKDDSKGKGLSL
NDQFSFGDMGLLQSNTNVNNELISIQSPTLTLEVVRRLGLNVEYYADGRYYKEVLYGQEL
PYRVKFLGLKDTDNASLTLTILANGQFAISNLMLNDNELQTQRITCSLGDTISAPIGKLV
IVRSESYLADKSKTRPSQIYVSYQNLYNVQELYSSGLKASINNDKASIIDIAYQDRSIQR
AEDFLNMLINV
DOMAINcd621/809TSINIDSGKTFITLNLAASFAAKGHRVLMIDADMRVASLSAFGPVEGDGLSALLAGRATN
YHGLISSSLLDNLYILPVGTLPPNPTELLAGQNFAELLESLRQEYDYIFIDCPPVAIVAD
ATLISRHIDMTVFVARVGLLDKSSLPVLESYYRESRYPNMVLVVNGTELDNRYGYNRGYG
ASHGYYAKK
SITEWalker A628/630GKT
SITEWalker A'648/655LMIDADMR
SITEWalker B728/734IFIDCPP
SITE-725/-727YDY
SITEY Cluster771/806YYRESRYPNMVLVVNGTELDNRYGYNRGYGASHGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQEENSRSAQGALAEQDSFLSLRDLWAMCWARKFWFVLSLGLFLGGAILYILITPPVYKRTATLLIKDDSKGKGLSLND
                  SFLSLRDLWAMCWARKFWFVLSLGLFLGGAILYILITPPVYKRTATLLIKDDSKGKGLSLND

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFSFGDMGLLQSNTNVNNELISIQSPTLTLEVVRRLGLNVEYYADGRYYKEVLYGQELPYRVKFLGLKDTDNASLTLTIL
QFSFGDMGLLQSNTNVNNELISIQSPTLTLEVVRRLGLNVEYYADGRYYKEVLYGQELPYRVKFLGLKDTDNASLTLTIL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANGQFAISNLMLNDNELQTQRITCSLGDTISAPIGKLVIVRSESYLADKSKTRPSQIYVSYQNLYNVQELYSSGLKASIN
ANGQFAISNLMLNDNELQTQRITCSLGDTISAPIGKLVIVRSESYLADKSKTRPSQIYVSYQNLYNVQELYSSGLKASIN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDKASIIDIAYQDRSIQRAEDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHVDKDISSFKSANLIPDLK
NDKASIIDIAYQDRSIQRAEDFLNMLINV                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETTRIYLDQTSEAEAQLLDLSNQLYMARYIRQHLGTDTNATQLIPAISGIGNKLIDQQIGEYNQKMLERNSLRANSSDEN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIVQDLTTQIGAMRSIILSSLDNQILTLDNQARSLKTRSGQATARISANPTQAEYLISVERQQKIKEALYLFLLQKREEN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELSQAFSAYNTRVITPPIGKMMPISPLRRNILLAALVLGLLLPVALIYLSESMNTALRSCRDLEGMTIPIAGELPALEPT


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISGLRGWLGRLFKKKKSMKKDIRFVVQENNRNMINEAFRLVRTNVEFMLTNKEGARVIATTSINIDSGKTFITLNLAASF
                                                            TSINIDSGKTFITLNLAASF
                                                                   GKT          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAKGHRVLMIDADMRVASLSAFGPVEGDGLSALLAGRATNYHGLISSSLLDNLYILPVGTLPPNPTELLAGQNFAELLES
AAKGHRVLMIDADMRVASLSAFGPVEGDGLSALLAGRATNYHGLISSSLLDNLYILPVGTLPPNPTELLAGQNFAELLES
       LMIDADMR                                                                 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRQEYDYIFIDCPPVAIVADATLISRHIDMTVFVARVGLLDKSSLPVLESYYRESRYPNMVLVVNGTELDNRYGYNRGYG
LRQEYDYIFIDCPPVAIVADATLISRHIDMTVFVARVGLLDKSSLPVLESYYRESRYPNMVLVVNGTELDNRYGYNRGYG
       IFIDCPP                                    YYRESRYPNMVLVVNGTELDNRYGYNRGYG
         
....:....
ASHGYYAKK
ASHGYYAKK
ASHGYY   

© 1998-2019