BYKdb

Annotate results for A0A0A2G557

A0A0A2G557 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A2G557
DOMAINtad22/268QMISLSDIFYLLRQNWYYFIACLLIALICGYVYIKSTPNSYERTASVLVNTKSDISGPLA
DIMKISGTDIGGIKGNDKIENEIIIFRTERLLSRVIDELNLRVTYRKKEGLRSKKLYKET
PIRLTLLNTSDTLSGSFSLSFIEENKVSLSNFEGDFEQLSSAPKMIVSLGETIETPIGSF
FLTSNTIATSKKEPIEIIVNSKEKTVADLSKKLTISQSGKQSSVIDLRFKDENTDFAEDF
LNTLISQ
DOMAINcd630/825TSALPNSGKTFVAANLAHSFRTLQKRVLLIDGDIRKGSLTAALRLNLSKQTEGLSAYLSN
SSLSVEDVVVPHNDDVIFDFLPAGVFPPNPSELLLSPRFEELISILRTLYDYIIIDAVPF
MNMADAQIIAKACDLTLMVVREGSTPRALLREINFIHKNKYFEKVALVLNDAGSSQHISG
RGYGYQYYSSEYQSYF
SITEWalker A637/639GKT
SITEWalker A'657/664LLIDGDIR
SITE-705/-711VIFDFLP
SITE-739/-741YDY
SITEY Cluster812/824YGYQYYSSEYQSY
SITEWalker B742/748IIIDAVP
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNNLYTNPEEGFIENNLSEEQMISLSDIFYLLRQNWYYFIACLLIALICGYVYIKSTPNSYERTASVLVNTKSDISGPL
                     QMISLSDIFYLLRQNWYYFIACLLIALICGYVYIKSTPNSYERTASVLVNTKSDISGPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADIMKISGTDIGGIKGNDKIENEIIIFRTERLLSRVIDELNLRVTYRKKEGLRSKKLYKETPIRLTLLNTSDTLSGSFSL
ADIMKISGTDIGGIKGNDKIENEIIIFRTERLLSRVIDELNLRVTYRKKEGLRSKKLYKETPIRLTLLNTSDTLSGSFSL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFIEENKVSLSNFEGDFEQLSSAPKMIVSLGETIETPIGSFFLTSNTIATSKKEPIEIIVNSKEKTVADLSKKLTISQSG
SFIEENKVSLSNFEGDFEQLSSAPKMIVSLGETIETPIGSFFLTSNTIATSKKEPIEIIVNSKEKTVADLSKKLTISQSG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQSSVIDLRFKDENTDFAEDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDVDQEIERFKQNNQIANIAS
KQSSVIDLRFKDENTDFAEDFLNTLISQ                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAEVYIESSKEITKQTIEVNNALAVAGFIKEHLTNPSSANGLIPASSGLEDLASNSLIKEYNTLYLYREQLLSESGQTNP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIETQQKQLESLRKAIIKSIDNYIKSLNIKLSSINKQSDKNEGKISSVPMQERIITSIYRNQKIKEELYLFLLNAREKNA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSIEGAVSDVQLIQPAVGSSTPIAPKKALIMLAALVLGLLIPAAHLYIRFMMNNTVRGRKDLETYTQIPILGEVPHSTRL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKKQNILFHKFLDLFRSPGKRHSNKRYQRRANMLLGSKIERDFVSESFSVLRSNMAFMLTGEECKIITLTSALPNSGKTF
                                                                     TSALPNSGKTF
                                                                            GKT 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAANLAHSFRTLQKRVLLIDGDIRKGSLTAALRLNLSKQTEGLSAYLSNSSLSVEDVVVPHNDDVIFDFLPAGVFPPNPS
VAANLAHSFRTLQKRVLLIDGDIRKGSLTAALRLNLSKQTEGLSAYLSNSSLSVEDVVVPHNDDVIFDFLPAGVFPPNPS
                LLIDGDIR                                                        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELLLSPRFEELISILRTLYDYIIIDAVPFMNMADAQIIAKACDLTLMVVREGSTPRALLREINFIHKNKYFEKVALVLND
ELLLSPRFEELISILRTLYDYIIIDAVPFMNMADAQIIAKACDLTLMVVREGSTPRALLREINFIHKNKYFEKVALVLND
                     IIIDAVP                                                    
       810       820        
....:....|....:....|....:...
AGSSQHISGRGYGYQYYSSEYQSYFSQK
AGSSQHISGRGYGYQYYSSEYQSYF   
           YGYQYYSSEYQSY    

© 1998-2019