BYKdb

Annotate results for A0A0A2HT71

A0A0A2HT71 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A2HT71
DOMAINtad1/194MHLRDYLAVIRKRRTVVLIVLGLIFFSTVIATFTATPIYTAASQVLIERNRSNSGLEYQS
YAYEPEFLDTQTEIIRSANVARKVVARLKLATQYRHYFLEDDKNGLSLIGTVRKAFSGMI
AGIGSFFAGDDDRKTGSKDIFETVLPKSDEEIIAGIIQGGLSVKPLKNTKIVTITYADKN
PAVAKLVADAVVQA
DOMAINcd485/671TSMEAQDGKSSTTVNLARTLAQGGNSVLVIDCDLRRPRMHSLLGMDNSVGLSRFLAGNCG
PDIIFKIQDEAISLIPSGPVPPDPAELLGSKKMKDLIDQMNGQFDFVLLDSPPIQSVTDS
LALSRFVSGTILVVRAGKTTFEVLEGGLKKLGDINSRVLGFVLNGIKQRDAGKHYYGYHS
YYARDDD
SITE-621/-623GKT
SITEWalker A'512/519LVIDCDLR
SITEWalker B591/597VLLDSPP
SITEY Cluster659/666YYGYHSYY
SITEWalker A492/494GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHLRDYLAVIRKRRTVVLIVLGLIFFSTVIATFTATPIYTAASQVLIERNRSNSGLEYQSYAYEPEFLDTQTEIIRSANV
MHLRDYLAVIRKRRTVVLIVLGLIFFSTVIATFTATPIYTAASQVLIERNRSNSGLEYQSYAYEPEFLDTQTEIIRSANV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARKVVARLKLATQYRHYFLEDDKNGLSLIGTVRKAFSGMIAGIGSFFAGDDDRKTGSKDIFETVLPKSDEEIIAGIIQGG
ARKVVARLKLATQYRHYFLEDDKNGLSLIGTVRKAFSGMIAGIGSFFAGDDDRKTGSKDIFETVLPKSDEEIIAGIIQGG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVKPLKNTKIVTITYADKNPAVAKLVADAVVQAYIDELLEIKLATSNYSLKWMNSKAAEERDKLEKSERDLQSYMREND
LSVKPLKNTKIVTITYADKNPAVAKLVADAVVQA                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVTVENKLTVLPQKLSEVGVQLSXXXLSKKFGRKHPMMVKANDELRILREERRFEIDRIVSSVKNSLALASSKKKSLDEL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASTKLEVLNLNERFVQYSIMKREVDSNRLVYDTLQAGIKKEGVTEQSQSINVWVVKPAELPGAPTKPNKKRNILIGLIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLCSGVGLAFFIDYLDNTIRQPKELEERFGLTVLGAVDDMRGDGQDIESFIKLQPLSPTAESYRLIRTSLLLSSAEHPPK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLLVTSMEAQDGKSSTTVNLARTLAQGGNSVLVIDCDLRRPRMHSLLGMDNSVGLSRFLAGNCGPDIIFKIQDEAISLIP
    TSMEAQDGKSSTTVNLARTLAQGGNSVLVIDCDLRRPRMHSLLGMDNSVGLSRFLAGNCGPDIIFKIQDEAISLIP
           GKS                 LVIDCDLR                                         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGPVPPDPAELLGSKKMKDLIDQMNGQFDFVLLDSPPIQSVTDSLALSRFVSGTILVVRAGKTTFEVLEGGLKKLGDINS
SGPVPPDPAELLGSKKMKDLIDQMNGQFDFVLLDSPPIQSVTDSLALSRFVSGTILVVRAGKTTFEVLEGGLKKLGDINS
                              VLLDSPP                                           
       650       660       670 
....:....|....:....|....:....|.
RVLGFVLNGIKQRDAGKHYYGYHSYYARDDD
RVLGFVLNGIKQRDAGKHYYGYHSYYARDDD
                  YYGYHSYY     
© 1998-2019