BYKdb

Annotate results for A0A0A2TSP8

A0A0A2TSP8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A2TSP8
DOMAINcd41/229TSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQHKLFGLDNAQGLSVALVQDKD
YRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
AAILAQEVDGVILVLASGEVNKEFAQRAKELLDKVGAKILGAVLNKADTKTSEYYYYYYY
HGSDDTKKK
SITEWalker A48/50GKT
SITEWalker A'68/75LIIDADLR
SITEWalker B148/154VLIDTPP
SITE-101/-104YRQY
SITE-64/-66GKT
SITEY Cluster214/220YYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAYSLVTFEQTKSPIAEAYRTLRTNVQFTCVDSDTRKIMITSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQH
                                        TSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQH
                                               GKT                 LIIDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLFGLDNAQGLSVALVQDKDYRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
KLFGLDNAQGLSVALVQDKDYRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
                                                                   VLIDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAILAQEVDGVILVLASGEVNKEFAQRAKELLDKVGAKILGAVLNKADTKTSEYYYYYYYHGSDDTKKKHKRRKDRSAPS
AAILAQEVDGVILVLASGEVNKEFAQRAKELLDKVGAKILGAVLNKADTKTSEYYYYYYYHGSDDTKKK           
                                                     YYYYYYY                    
  
..
EG


© 1998-2019