BYKdb

Annotate results for A0A0A2TXU8

A0A0A2TXU8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A2TXU8
DOMAINcd47/227ASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDLRKPAVHRMFNVPNHVGLTSVLSSQYK
VTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEVYDVILFDTPPVLAVTD
ALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKRRNAYYGEN
A
SITEWalker A54/56GKT
SITEWalker A'74/81LLMDTDLR
SITEWalker B154/160ILFDTPP
SITEY Cluster222/223YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRLTNEKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
                                              ASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
                                                     GKT                 LLMDTDL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPAVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEVYDVILFDTPP
RKPAVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEVYDVILFDTPP
R                                                                        ILFDTPP
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKRRNAYYGENA
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKRRNAYYGENA
                                                             YY    
© 1998-2019