BYKdb

Annotate results for A0A0A2TZ57

A0A0A2TZ57 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A2TZ57
DOMAINcd50/231TSPGPGEGKSMTAANIATVFAQQGKKVLLIDADLRKPTMHYTFRVDNSKGLSNYLVGSDA
LFETAAASGIENLHVMPCGPIPPNPAELLGSKAMNGLIEEAQQEYDLVIFDTPPVLAVTD
SQILANMCDGALLVVRSKQTENDSAQKAKELLENAHAKILGVVLNGKQIKKSNYYYYYGT
NA
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDADLR
SITEWalker B157/163VIFDTPP
SITEY Cluster223/227YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKKNLLMKARTLITNFNPKSPISEQYRTIRTNLQFASVDRDLRTMIVTSPGPGEGKSMTAANIATVFAQQGKKVLLID
                                                 TSPGPGEGKSMTAANIATVFAQQGKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPTMHYTFRVDNSKGLSNYLVGSDALFETAAASGIENLHVMPCGPIPPNPAELLGSKAMNGLIEEAQQEYDLVIFD
ADLRKPTMHYTFRVDNSKGLSNYLVGSDALFETAAASGIENLHVMPCGPIPPNPAELLGSKAMNGLIEEAQQEYDLVIFD
ADLR                                                                        VIFD
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
TPPVLAVTDSQILANMCDGALLVVRSKQTENDSAQKAKELLENAHAKILGVVLNGKQIKKSNYYYYYGTNA
TPPVLAVTDSQILANMCDGALLVVRSKQTENDSAQKAKELLENAHAKILGVVLNGKQIKKSNYYYYYGTNA
TPP                                                           YYYYY    
© 1998-2019