BYKdb

Annotate results for A0A0A2WPP3

A0A0A2WPP3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A2WPP3
DOMAINtad19/190DTINLREYWQVLRDRRWVIAGVTAAVVALALAVTLLATPIFRASSTLQIERDTMKIMDVE
GLTPTESPMDRDFYQTQYELLRSRSLARRVVQDLRLVQAPLFADLVANVDAGLEDKQATP
AAQREARERALVETALESLTIEPVRNSRLVRVNFDSADPALSARIANAWADA
DOMAINcd526/715TSAGPSEGKSTTARELARNIAQTGKRVVLVDADLRKPSLHRLLDVSNASGLSNVLAGAAD
IADVLRAAPGETFSVITAGPLPPNPPELLAGDRLARMLDALRDRFDIVVIDGPPVLGLAD
APLLAHVAEGTLLIAAAGHTRRDALRGALRRLSSTRGRMLGTLLTRFDLERKGDDYGYGS
YAYYGYGTKQ
SITEWalker A533/535GKS
SITEWalker A'553/560VLVDADLR
SITEWalker B633/639VVIDGPP
SITEY Cluster701/711YGYGSYAYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLVNLQAQPAPDGREDEDTINLREYWQVLRDRRWVIAGVTAAVVALALAVTLLATPIFRASSTLQIERDTMKIMDVEGL
                  DTINLREYWQVLRDRRWVIAGVTAAVVALALAVTLLATPIFRASSTLQIERDTMKIMDVEGL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPTESPMDRDFYQTQYELLRSRSLARRVVQDLRLVQAPLFADLVANVDAGLEDKQATPAAQREARERALVETALESLTIE
TPTESPMDRDFYQTQYELLRSRSLARRVVQDLRLVQAPLFADLVANVDAGLEDKQATPAAQREARERALVETALESLTIE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVRNSRLVRVNFDSADPALSARIANAWADAFIASNLERRFDASSYARKYLEERLAQSKARLEDSEKALVAFATQEQIVNV
PVRNSRLVRVNFDSADPALSARIANAWADA                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GENQPSLSAQNLGELNAALALAQAARIRAQAAWDQARAGDGLGLPQVVQSPLIQKLRESRSLLAAQYQEQLRTFKADYPD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRLAGQIAETDRQIATEVAHIRAAVRSEYDAARAQEGLLEGRMSGLKNDVLDLQGRSIQYNILRREAETNRQLYDGLLQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKEIGVVGGVGANNVSVIDRAFVPERRHSPRIPLNLAVGVLLGLFAGVLTAFLLHHLDRRMHSPQALEEALGLPVLGAI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRLPNGTSPQMASTDARSPFAEAYRSVRTSLQFATDHGLPRSLLITSAGPSEGKSTTARELARNIAQTGKRVVLVDADLR
                                             TSAGPSEGKSTTARELARNIAQTGKRVVLVDADLR
                                                    GKS                 VLVDADLR
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSLHRLLDVSNASGLSNVLAGAADIADVLRAAPGETFSVITAGPLPPNPPELLAGDRLARMLDALRDRFDIVVIDGPPV
KPSLHRLLDVSNASGLSNVLAGAADIADVLRAAPGETFSVITAGPLPPNPPELLAGDRLARMLDALRDRFDIVVIDGPPV
                                                                        VVIDGPP 
       650       660       670       680       690       700       710       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
LGLADAPLLAHVAEGTLLIAAAGHTRRDALRGALRRLSSTRGRMLGTLLTRFDLERKGDDYGYGSYAYYGYGTKQAA
LGLADAPLLAHVAEGTLLIAAAGHTRRDALRGALRRLSSTRGRMLGTLLTRFDLERKGDDYGYGSYAYYGYGTKQ  
                                                            YGYGSYAYYGY      

© 1998-2019