BYKdb

Annotate results for A0A0A3HN53

A0A0A3HN53 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A3HN53
DOMAINcd55/236TSSLAGEGKSTIAANIAVVFAQEGKKVLLIDADLRKPTLQFTFNIRDHIGLTHVLIGKNY
YFNAIQETPIPGLDVLPCGAIPPNPTELLSSKNMDTLLIDLKEKYDLIILDGPPLITISD
SQILGNKCDGTLFIISSGISKKEDLLKSEEILSTSKAKIIGIVLNNYKLSKNDYQNYYTY
TN
SITEWalker A62/64GKS
SITEWalker A'82/89LLIDADLR
SITEWalker B162/168IILDGPP
SITE-114/-115YY
SITEY Cluster228/234YQNYYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNKKNKKNKKQAKKPRKLVTMSDDNAFISEQFRTIRANINFSLPGQESKTILITSSLAGEGKSTIAANIAVVFAQEGKK
                                                      TSSLAGEGKSTIAANIAVVFAQEGKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLIDADLRKPTLQFTFNIRDHIGLTHVLIGKNYYFNAIQETPIPGLDVLPCGAIPPNPTELLSSKNMDTLLIDLKEKYD
VLLIDADLRKPTLQFTFNIRDHIGLTHVLIGKNYYFNAIQETPIPGLDVLPCGAIPPNPTELLSSKNMDTLLIDLKEKYD
 LLIDADLR                                                                       
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
LIILDGPPLITISDSQILGNKCDGTLFIISSGISKKEDLLKSEEILSTSKAKIIGIVLNNYKLSKNDYQNYYTYTN
LIILDGPPLITISDSQILGNKCDGTLFIISSGISKKEDLLKSEEILSTSKAKIIGIVLNNYKLSKNDYQNYYTYTN
 IILDGPP                                                           YQNYYTY  
© 1998-2019