BYKdb

Annotate results for A0A0A3ID23

A0A0A3ID23 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A3ID23
DOMAINcd54/233TSATPGEGKSTNAANIGVVFAQEGKRVIIVDADLRKPTMHYTFLLQNARGLSNLLTRHFT
MSEVINSTDIANLFVLTSGPIPPNPAELLASNVMESVIENLKKEFDIIIFDAPPILSVTD
AQILSNKCDGTLLIVNSGVAENESVLKAKSNLEASKANILGVILNNYKMPLHQYYEQYYY
SITEWalker A61/63GKS
SITEWalker A'81/88IIVDADLR
SITEWalker B161/167IIFDAPP
SITEY Cluster227/233YYEQYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFWKKKKKKKLVKMARKLVTIANGQSFISEQFRTIRTNITFSMPDKEIKTILVTSATPGEGKSTNAANIGVVFAQEGKRV
                                                     TSATPGEGKSTNAANIGVVFAQEGKRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIVDADLRKPTMHYTFLLQNARGLSNLLTRHFTMSEVINSTDIANLFVLTSGPIPPNPAELLASNVMESVIENLKKEFDI
IIVDADLRKPTMHYTFLLQNARGLSNLLTRHFTMSEVINSTDIANLFVLTSGPIPPNPAELLASNVMESVIENLKKEFDI
IIVDADLR                                                                        
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
IIFDAPPILSVTDAQILSNKCDGTLLIVNSGVAENESVLKAKSNLEASKANILGVILNNYKMPLHQYYEQYYY
IIFDAPPILSVTDAQILSNKCDGTLLIVNSGVAENESVLKAKSNLEASKANILGVILNNYKMPLHQYYEQYYY
IIFDAPP                                                           YYEQYYY
© 1998-2019