BYKdb

Annotate results for A0A0A3IGK6

A0A0A3IGK6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A3IGK6
DOMAINcd52/233TSASPAEGKSTTASNISVVFAQEGKKVLLIDADMRKPTSHHTFKLTNMYGLSTVLTRQGE
VEEAIQKTDVENLWVMTSGPIPPNPAELLASKNMDFLYSRLQEDFDLLVFDTPPILSVSD
AQIVSNKVDGTVLVINTGQSEKESSLKAKELLLSAKANILGVILNNFNLEKNQYYYQYYG
EG
SITEWalker A59/61GKS
SITEWalker A'79/86LLIDADMR
SITEWalker B159/165LVFDTPP
SITEY Cluster225/230YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLKRKRKKSNTMSRKIVAATHPKSINAEQYRTIRTNINFSMPDQELRTLLVTSASPAEGKSTTASNISVVFAQEGKKVLL
                                                   TSASPAEGKSTTASNISVVFAQEGKKVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRKPTSHHTFKLTNMYGLSTVLTRQGEVEEAIQKTDVENLWVMTSGPIPPNPAELLASKNMDFLYSRLQEDFDLLV
IDADMRKPTSHHTFKLTNMYGLSTVLTRQGEVEEAIQKTDVENLWVMTSGPIPPNPAELLASKNMDFLYSRLQEDFDLLV
IDADMR                                                                        LV
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
FDTPPILSVSDAQIVSNKVDGTVLVINTGQSEKESSLKAKELLLSAKANILGVILNNFNLEKNQYYYQYYGEG
FDTPPILSVSDAQIVSNKVDGTVLVINTGQSEKESSLKAKELLLSAKANILGVILNNFNLEKNQYYYQYYGEG
FDTPP                                                           YYYQYY   
© 1998-2019