BYKdb

Annotate results for A0A0A3INZ8

A0A0A3INZ8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A3INZ8
DOMAINcd58/241TSTIPGEGKSTTTANLGVVFAQEGKRVLIIDADLRKPTLHYAFGLFNTVGLSNVLVRKRA
FYESIQETSVSGLAILPSGPIPSNPAELLSSKTMDALLDELKNLYDIIIIDAPPVLPVTD
AQVLANKCDGTLLVANAGVITKELIIKAKSILATSQANMIGVVLNNCKMPRDHKRYYGYY
GAGH
SITEWalker A65/67GKS
SITEWalker A'85/92LIIDADLR
SITEWalker B165/171IIIDAPP
SITEY Cluster233/237YYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFGRKNRDRKKQIKLLKAGRKLITLLDGSSIISEQFRTIRTNITFAMPDCEVKTILVTSTIPGEGKSTTTANLGVVFAQE
                                                         TSTIPGEGKSTTTANLGVVFAQE
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKRVLIIDADLRKPTLHYAFGLFNTVGLSNVLVRKRAFYESIQETSVSGLAILPSGPIPSNPAELLSSKTMDALLDELKN
GKRVLIIDADLRKPTLHYAFGLFNTVGLSNVLVRKRAFYESIQETSVSGLAILPSGPIPSNPAELLSSKTMDALLDELKN
    LIIDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYDIIIIDAPPVLPVTDAQVLANKCDGTLLVANAGVITKELIIKAKSILATSQANMIGVVLNNCKMPRDHKRYYGYYGAG
LYDIIIIDAPPVLPVTDAQVLANKCDGTLLVANAGVITKELIIKAKSILATSQANMIGVVLNNCKMPRDHKRYYGYYGAG
    IIIDAPP                                                             YYGYY   
 
.
H
H

© 1998-2019