BYKdb

Annotate results for A0A0A3J677

A0A0A3J677 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A3J677
DOMAINcd45/222TSSVPGEGKTTTAANLAVVFAQEGKKVLIVDSDMRKPALHYTFDILNEKGLSNVLTRHQN
HFLALSNTNIENLFIIPSGPIPPNPSELLSTQKFEIFLEEVKELYDLIIFDAPPLLSVTD
AQILSHKCDGTILVVKSGFVDKVDVLKAKTSLNTVHAKILGVVLNNYNTTNSNYYEYY
SITEWalker A52/54GKT
SITEWalker A'72/79LIVDSDMR
SITEWalker B152/158IIFDAPP
SITEY Cluster218/222YYEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVPLARKLITSTSPKSIISEQFRTIRTNIEFSSPDQTIKTILVTSSVPGEGKTTTAANLAVVFAQEGKKVLIVDSDMRK
                                            TSSVPGEGKTTTAANLAVVFAQEGKKVLIVDSDMRK
                                                   GKT                 LIVDSDMR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PALHYTFDILNEKGLSNVLTRHQNHFLALSNTNIENLFIIPSGPIPPNPSELLSTQKFEIFLEEVKELYDLIIFDAPPLL
PALHYTFDILNEKGLSNVLTRHQNHFLALSNTNIENLFIIPSGPIPPNPSELLSTQKFEIFLEEVKELYDLIIFDAPPLL
                                                                       IIFDAPP  
       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
SVTDAQILSHKCDGTILVVKSGFVDKVDVLKAKTSLNTVHAKILGVVLNNYNTTNSNYYEYY
SVTDAQILSHKCDGTILVVKSGFVDKVDVLKAKTSLNTVHAKILGVVLNNYNTTNSNYYEYY
                                                         YYEYY
© 1998-2019