BYKdb

Annotate results for A0A0A3Y022

A0A0A3Y022 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A3Y022
DOMAINtad26/205IGEIISAALGFLWRQYLVLILAAVLGLTASLIYLLITPPTYTAQVQVMLENAKTQFIQQQ
SILAEPAFDLTLFETQVQVLKSKAMAIKVINQLKLADDPDFKQPPPSAPSTWQRLRAALL
PPPPDDLQPPPTGEPLEGIITTFQKRLVVERIGFSNLIEINFSSSNPTRAAQIANAIAKI
DOMAINcd572/762TSTLPNEGKTTIAASLAQLIAHSGKSCIVVDADLRNPSLSASLAANATTGIVDVISHGRS
LEETIWRDQKTNLAILPAVSPMPVLHTSEVLAADSMRKLFDQLRSTYDYVIVDLPPLTPL
VDVRSTTTFIDCYVLVVEWGQTKAEVVKHALHTAPNVYECLIGAVLNKTDIKAMSRYDTQ
CRDYYRDEHYI
SITEWalker A579/581GKT
SITEWalker A'599/606IVVDADLR
SITEWalker B681/687VIVDLPP
SITE-678/-680YDY
SITE-595/-597GKS
SITEY Cluster755/764YYRDEHYIRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQTNMLQAERLRAPAFNQEAEGGGIGEIISAALGFLWRQYLVLILAAVLGLTASLIYLLITPPTYTAQVQVMLENAKTQ
                         IGEIISAALGFLWRQYLVLILAAVLGLTASLIYLLITPPTYTAQVQVMLENAKTQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIQQQSILAEPAFDLTLFETQVQVLKSKAMAIKVINQLKLADDPDFKQPPPSAPSTWQRLRAALLPPPPDDLQPPPTGEP
FIQQQSILAEPAFDLTLFETQVQVLKSKAMAIKVINQLKLADDPDFKQPPPSAPSTWQRLRAALLPPPPDDLQPPPTGEP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEGIITTFQKRLVVERIGFSNLIEINFSSSNPTRAAQIANAIAKIYLADQEKAKLETNRRARNWMQERLQELGEQALEAE
LEGIITTFQKRLVVERIGFSNLIEINFSSSNPTRAAQIANAIAKI                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAVSAYKSKNNVISTGGKPIDDQQITELSSRLVAARAQTSDAAAKLNRYEAILEANPANSPTIGNLDAAGSDALSSPIIT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRQQYMELERRVAEWVPRFGRDHAAVVNLRNRMRELRGSILDEVKRYAETSRSEFEVAKQRQQEIEKQMSGAVEQSRST


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAEITIRELESKAKSLRNLHDTFLQRYVGAAQQESFPIAEARVMYVAVPPQSKSKPKGAMVMALGLVGGLGLGLGLGLF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REMMDRVFRTSAQIESTLGLPCLSLVPALRAKRAWAWSLDHDMRRRRMSSSSTFHGTVVGKPLSRYAESIRAIKLAIDLN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSKASNKVIGITSTLPNEGKTTIAASLAQLIAHSGKSCIVVDADLRNPSLSASLAANATTGIVDVISHGRSLEETIWRDQ
           TSTLPNEGKTTIAASLAQLIAHSGKSCIVVDADLRNPSLSASLAANATTGIVDVISHGRSLEETIWRDQ
                  GKT                 IVVDADLR                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTNLAILPAVSPMPVLHTSEVLAADSMRKLFDQLRSTYDYVIVDLPPLTPLVDVRSTTTFIDCYVLVVEWGQTKAEVVKH
KTNLAILPAVSPMPVLHTSEVLAADSMRKLFDQLRSTYDYVIVDLPPLTPLVDVRSTTTFIDCYVLVVEWGQTKAEVVKH
                                        VIVDLPP                                 
       730       740       750       760       770
....:....|....:....|....:....|....:....|....:....|
ALHTAPNVYECLIGAVLNKTDIKAMSRYDTQCRDYYRDEHYIRYGLTGSN
ALHTAPNVYECLIGAVLNKTDIKAMSRYDTQCRDYYRDEHYI        
                                  YYRDEHYIRY      

© 1998-2019