BYKdb

Annotate results for A0A0A5G2V2

A0A0A5G2V2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A5G2V2
DOMAINcd52/231TSSGPSEGKSSITANLAVVFAQQGKSVLLIDADLRKPTLHYTLRTNNTVGLSSCLVGTQT
LEETVQTTAIDNLYAMTSGPIPPNPSELLGSRAMRKLIHDARAKYDVVIFDTPPVLAVTD
AQILSNLCDGTILVVRHKQTDIEQAKRAKELLDKAEGKLIGTVLNDMNKQKQNYYYYYGD
SITE-75/-77GKS
SITEWalker A'79/86LLIDADLR
SITEWalker B159/165VIFDTPP
SITEY Cluster225/229YYYYY
SITEWalker A59/61GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MWKKQRKPSRHQARTLITDLNPKSPIAEQFRTIRTNINFSFVDTDMETLMVTSSGPSEGKSSITANLAVVFAQQGKSVLL
                                                   TSSGPSEGKSSITANLAVVFAQQGKSVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADLRKPTLHYTLRTNNTVGLSSCLVGTQTLEETVQTTAIDNLYAMTSGPIPPNPSELLGSRAMRKLIHDARAKYDVVI
IDADLRKPTLHYTLRTNNTVGLSSCLVGTQTLEETVQTTAIDNLYAMTSGPIPPNPSELLGSRAMRKLIHDARAKYDVVI
IDADLR                                                                        VI
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
FDTPPVLAVTDAQILSNLCDGTILVVRHKQTDIEQAKRAKELLDKAEGKLIGTVLNDMNKQKQNYYYYYGD
FDTPPVLAVTDAQILSNLCDGTILVVRHKQTDIEQAKRAKELLDKAEGKLIGTVLNDMNKQKQNYYYYYGD
FDTPP                                                           YYYYY  
© 1998-2019