BYKdb

Annotate results for A0A0A5GCT0

A0A0A5GCT0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A5GCT0
DOMAINcd52/233TSAGPSEGKSMTASNVATVFAQQGKRVLLIDADLRKPTVHYTFRVDNMKGLSTYLVGQGS
LSETVSESHIENLDILPSGPIPPNPAEILGSQAMSTLIQEAQQSYDLVIFDTPPVLAVTD
SQILANACDGVLLVVRSKQTENEAAEKAKELLEKAQAKLLGVVLNGKEIKNSNYYYYYGN
SS
SITEWalker A59/61GKS
SITEWalker A'79/86LLIDADLR
SITEWalker B159/165VIFDTPP
SITEY Cluster225/229YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARSKKKSLLNKARTLITNTNPKSPISEQYRTIRTNLQFASVDSELRTMLVTSAGPSEGKSMTASNVATVFAQQGKRVLL
                                                   TSAGPSEGKSMTASNVATVFAQQGKRVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADLRKPTVHYTFRVDNMKGLSTYLVGQGSLSETVSESHIENLDILPSGPIPPNPAEILGSQAMSTLIQEAQQSYDLVI
IDADLRKPTVHYTFRVDNMKGLSTYLVGQGSLSETVSESHIENLDILPSGPIPPNPAEILGSQAMSTLIQEAQQSYDLVI
IDADLR                                                                        VI
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
FDTPPVLAVTDSQILANACDGVLLVVRSKQTENEAAEKAKELLEKAQAKLLGVVLNGKEIKNSNYYYYYGNSS
FDTPPVLAVTDSQILANACDGVLLVVRSKQTENEAAEKAKELLEKAQAKLLGVVLNGKEIKNSNYYYYYGNSS
FDTPP                                                           YYYYY    
© 1998-2019