BYKdb

Annotate results for A0A0A5GPA9

A0A0A5GPA9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A5GPA9
DOMAINtad3/141QAFGLKEVYQVIRRRVVLLSVVTLLVVIIGIAISLLLPRTYEGEGALLVNFTSVKSDEDE
ISSSEIETNLRLIETYKSILISPRIMDKVKAQYGSDLEMEELVQRFTIGTNAESQIITVQ
AVGPSKEAASELVNVTLDT
DOMAINcd280/455TSTHSSEGKSITAANIAYSMAMDHVNTVFVDLDLRKGVGNHLFNNPVRKGATNYLEGYAS
IDEVVSRTDIPHLSYVAKGPMPKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPLVVADA
VALSTRVDGCVFVVNAQKTNTEQVSKSLQRLNKVKATIFGVVLNRGVKETNAHYYY
SITEWalker A287/289GKS
SITEWalker A'307/314VFVDLDLR
SITEWalker B387/393VIIDTPP
SITE-333/-337YLEGY
SITEY Cluster453/455YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGQAFGLKEVYQVIRRRVVLLSVVTLLVVIIGIAISLLLPRTYEGEGALLVNFTSVKSDEDEISSSEIETNLRLIETYKS
  QAFGLKEVYQVIRRRVVLLSVVTLLVVIIGIAISLLLPRTYEGEGALLVNFTSVKSDEDEISSSEIETNLRLIETYKS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILISPRIMDKVKAQYGSDLEMEELVQRFTIGTNAESQIITVQAVGPSKEAASELVNVTLDTFQQEVESLMNLNNVQILTR
ILISPRIMDKVKAQYGSDLEMEELVQRFTIGTNAESQIITVQAVGPSKEAASELVNVTLDT                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNPDAHETPIKPNLLMNTILSLLLGLFLALLLVFLKEVIFTRADSEEKVEKVFRLSSLGVVPIISDEWNQKKEDLMQNDR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YFKLLPRLGTYSPITEAYRSIRTNLQYTLNQKSAKTVLFTSTHSSEGKSITAANIAYSMAMDHVNTVFVDLDLRKGVGNH
                                       TSTHSSEGKSITAANIAYSMAMDHVNTVFVDLDLRKGVGNH
                                              GKS                 VFVDLDLR      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFNNPVRKGATNYLEGYASIDEVVSRTDIPHLSYVAKGPMPKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPLVVADAV
LFNNPVRKGATNYLEGYASIDEVVSRTDIPHLSYVAKGPMPKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPLVVADAV
                                                                  VIIDTPP       
       410       420       430       440       450     
....:....|....:....|....:....|....:....|....:....|....:
ALSTRVDGCVFVVNAQKTNTEQVSKSLQRLNKVKATIFGVVLNRGVKETNAHYYY
ALSTRVDGCVFVVNAQKTNTEQVSKSLQRLNKVKATIFGVVLNRGVKETNAHYYY
                                                    YYY
© 1998-2019