BYKdb

Annotate results for A0A0A5GPK9

A0A0A5GPK9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A5GPK9
DOMAINcd51/232TSTGPSEGKSLTSGNLATTFAQQGKKVLLIDADLRKPTAQYTFRVPNVKGLSNYLVTKDS
TLTDLVHQTEIEHLDVLPSGPIPPNPSEILGSKAMVRLLEEALELYDQVVVDAPPVLAVT
DAQILANLVDGVLMVVRSKQTDNEAAIKAKKLLDAGNSKLLGVVLNDKEAKSSNYYYYYG
QS
SITEWalker A58/60GKS
SITEWalker A'78/85LLIDADLR
SITEWalker B159/165VVVDAPP
SITEY Cluster225/229YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARRKKNVTQKARNLITNLNPKSPISEQYRTIRTNLQFASVDNELRSLLITSTGPSEGKSLTSGNLATTFAQQGKKVLLI
                                                  TSTGPSEGKSLTSGNLATTFAQQGKKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTAQYTFRVPNVKGLSNYLVTKDSTLTDLVHQTEIEHLDVLPSGPIPPNPSEILGSKAMVRLLEEALELYDQVV
DADLRKPTAQYTFRVPNVKGLSNYLVTKDSTLTDLVHQTEIEHLDVLPSGPIPPNPSEILGSKAMVRLLEEALELYDQVV
DADLR                                                                         VV
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VDAPPVLAVTDAQILANLVDGVLMVVRSKQTDNEAAIKAKKLLDAGNSKLLGVVLNDKEAKSSNYYYYYGQS
VDAPPVLAVTDAQILANLVDGVLMVVRSKQTDNEAAIKAKKLLDAGNSKLLGVVLNDKEAKSSNYYYYYGQS
VDAPP                                                           YYYYY   
© 1998-2019