BYKdb

Annotate results for A0A0A6P8E3

A0A0A6P8E3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A6P8E3
DOMAINtad8/182DEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIK
EIYGIESFGKEYYQTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLS
PEVPLTAEKKRDAIIASLRDQLTISAIRNSRLVTISCDSSDKQLAAKVPNTLADL
DOMAINcd531/721TSSVPGEGKTTFSTNQALALGQMEKTLLIDADMRRPSIGKAFGLTKAPGLAELVAGTRKL
DECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTLLEKLSKEYAYIVIDTAPTMLV
SDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYYY
GKYGYYKNYYK
SITEWalker A538/540GKT
SITEWalker A'557/564LLIDADMR
SITEWalker B640/646IVIDTAP
SITE-637/-639YAY
SITEY Cluster707/730YYYYGKYGYYKNYYKSYYGGGHGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSQSDEDEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIKEIYGIESFGKEYY
       DEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIKEIYGIESFGKEYY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLSPEVPLTAEKKRDAIIASLRDQLTISAIRNSRLV
QTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLSPEVPLTAEKKRDAIIASLRDQLTISAIRNSRLV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TISCDSSDKQLAAKVPNTLADLYIESDLEAKLEMTNKAASWLTERVEGLRQNLSNSEKTLQEYMERKNLINVEGVKSVAK
TISCDSSDKQLAAKVPNTLADL                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQIEETASNLVNARQEYAQANSVYRQVKALRGKGSEAYESIPAVLNNGLVQSLKQAELDAERKVSELSERYGQRHPKIIA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSDLEKAKANTARQIQRVVEGLTKEYEVALANVKALERVLDDNKRKIKELNRKEYELKKLERDVAVNRQLYNMFLTRFK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETDASQDVQSLQSTIGRLIDLALVSNWPYKPKKRMIVAISLLLGFIFSTMLAFSLEYLDNTIKDGEDVEQKLGLPMLGSL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKLKLSNTEEFEPLWKFLKEPKTAFAESVRTLRTGAILSCLESEEKIFVITSSVPGEGKTTFSTNQALALGQMEKTLLID
                                                  TSSVPGEGKTTFSTNQALALGQMEKTLLID
                                                         GKT                LLID
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADMRRPSIGKAFGLTKAPGLAELVAGTRKLDECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTLLEKLSKEYAYI
ADMRRPSIGKAFGLTKAPGLAELVAGTRKLDECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTLLEKLSKEYAYI
ADMR                                                                           I
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIDTAPTMLVSDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYYYGKYGYYKNYY
VIDTAPTMLVSDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYYYGKYGYYKNYY
VIDTAP                                                            YYYYGKYGYYKNYY
       730     
....:....|....:
KSYYGGGHGYYNSDS
K              
KSYYGGGHGY     

© 1998-2019