BYKdb

Annotate results for A0A0A6PN53

A0A0A6PN53 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A6PN53
DOMAINtad1/134MLKITFNKHKWLILGLTLFLSLLTTFYVASLPSIYRSTAILLIGVEHNKEINSSQSNNYY
QTQLKILGARMLAEKLIDKLNLATHPAIAGKTIVETLMKGLNMTLVPNSQLVEISFESTD
AQLAAQIPNTLVEL
DOMAINcd339/529TSSIPNEGKTTFAINIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERD
LDECIHDHLSDNRRNLDIMPSGMAPPNPLELLSSPRFGELLYELSQEYEYIIIDSAPTIA
VSDTLVLTKYASSVLYVVKANATSYKLILEGLKRLRQVKAPVHNIILNQLDSDNPSKYYR
YGYGYGYGKND
SITEWalker A346/348GKT
SITEWalker A'365/372LLIDADLR
SITEWalker B449/455IIIDSAP
SITE-440/-474YELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLY
SITEY Cluster516/525YYRYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLKITFNKHKWLILGLTLFLSLLTTFYVASLPSIYRSTAILLIGVEHNKEINSSQSNNYYQTQLKILGARMLAEKLIDKL
MLKITFNKHKWLILGLTLFLSLLTTFYVASLPSIYRSTAILLIGVEHNKEINSSQSNNYYQTQLKILGARMLAEKLIDKL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLATHPAIAGKTIVETLMKGLNMTLVPNSQLVEISFESTDAQLAAQIPNTLVELYIENTLKTKLAMIKKASSQLTKHIEA
NLATHPAIAGKTIVETLMKGLNMTLVPNSQLVEISFESTDAQLAAQIPNTLVEL                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRNNLIKSEMALLTYKENHAPVDQKESQLKIKILQEEVDSNNKLYQKWVLRLQTLQEPQTTVGRLIEPASVSAIPYKPQK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KWIVAISLILALFFSTLLAFFLELMDKSLKTPEEVEKKLGLPLLTVLPKVKIDKTEDKIKARWMFLREPKSGYSESIRTA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTGILLSKLDTQHKVLIVTSSIPNEGKTTFAINIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERDLD
                  TSSIPNEGKTTFAINIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERDLD
                         GKT                LLIDADLR                            
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ECIHDHLSDNRRNLDIMPSGMAPPNPLELLSSPRFGELLYELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLYVVKANA
ECIHDHLSDNRRNLDIMPSGMAPPNPLELLSSPRFGELLYELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLYVVKANA
                                                IIIDSAP                         
       490       500       510       520         
....:....|....:....|....:....|....:....|....:....
TSYKLILEGLKRLRQVKAPVHNIILNQLDSDNPSKYYRYGYGYGYGKND
TSYKLILEGLKRLRQVKAPVHNIILNQLDSDNPSKYYRYGYGYGYGKND
                                   YYRYGYGYGY    
© 1998-2019