BYKdb

Annotate results for A0A0A6PQ76

A0A0A6PQ76 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A6PQ76
DOMAINcd67/257TSSIPNEGKTTFAINIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERD
LDECIHDHLSDNRRNLDIMPSGMAPPNPLELLSSPRFGELLYELSQEYEYIIIDSAPTIA
VSDTLVLTKYASSVLYVVKANATSYKLILEGLKRLRQVKAPVHNIILNQLDSDNPSKYYR
YGYGYGYGKND
SITEWalker A74/76GKT
SITEWalker A'93/100LLIDADLR
SITEWalker B177/183IIIDSAP
SITE-168/-202YELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLY
SITEY Cluster244/253YYRYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEVEKKLGLPLLTVLPKVKIDKTEDKIKARWMFLREPKSGYSESIRTARTGILLSKLDTQHKVLIVTSSIPNEGKTTFAI
                                                                  TSSIPNEGKTTFAI
                                                                         GKT    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERDLDECIHDHLSDNRRNLDIMPSGMAPPNPLELLSS
NIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERDLDECIHDHLSDNRRNLDIMPSGMAPPNPLELLSS
            LLIDADLR                                                            
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRFGELLYELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLYVVKANATSYKLILEGLKRLRQVKAPVHNIILNQLDSDN
PRFGELLYELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLYVVKANATSYKLILEGLKRLRQVKAPVHNIILNQLDSDN
                IIIDSAP                                                         
       250       
....:....|....:..
PSKYYRYGYGYGYGKND
PSKYYRYGYGYGYGKND
   YYRYGYGYGY    
© 1998-2019