BYKdb

Annotate results for A0A0A6QUH3

A0A0A6QUH3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A6QUH3
DOMAINtad13/204PLIDIGYYAHIIKSRWISIFLFTVLCSAISILVALSLTPTYKATATLLIESSQKKAISIE
EIVGIDTRAKEYYQTQFEILKSNQVAQRVIDKLDLKQYPEFNPSLKNTENGIVDFLKKSI
TSNSIFRTYFPEDNTPEISDSVKEEKVNRGVLNIFKSKLTISPIRNTQLVRISFESTSPS
LSADVANEVARA
DOMAINcd551/739SSSVPEEGKTTASINLAKSFSKLERVLLIDCDLRKPSISRRFDLPQSQMGLANIILMNAP
VRDCIVSIPNTKLDVLTAGMIAPNAQELLSSKMFSNLIERLSDKYDRIIIDTPPVLPVKD
AFIIGRLTKGIVLIVKSNSTTKSVFKHSMTLFAKHEITLDGVVLNQVVAPRKGTHTYSEY
ANYAYSHES
SITEWalker A558/560GKT
SITEWalker A'577/584LLIDCDLR
SITEWalker B658/664IIIDTPP
SITEY Cluster727/735YSEYANYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNHNQFENKEHEPLIDIGYYAHIIKSRWISIFLFTVLCSAISILVALSLTPTYKATATLLIESSQKKAISIEEIVGIDTR
            PLIDIGYYAHIIKSRWISIFLFTVLCSAISILVALSLTPTYKATATLLIESSQKKAISIEEIVGIDTR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKEYYQTQFEILKSNQVAQRVIDKLDLKQYPEFNPSLKNTENGIVDFLKKSITSNSIFRTYFPEDNTPEISDSVKEEKVN
AKEYYQTQFEILKSNQVAQRVIDKLDLKQYPEFNPSLKNTENGIVDFLKKSITSNSIFRTYFPEDNTPEISDSVKEEKVN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGVLNIFKSKLTISPIRNTQLVRISFESTSPSLSADVANEVARAFIENNLESKLLATKQATSWINTRLAELKNKLDVSER
RGVLNIFKSKLTISPIRNTQLVRISFESTSPSLSADVANEVARA                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLTFLEKQELIDDSGIIALTSSELANLTDRISEATERRIETQALYNALKGSTNTDATTLASISTISNHPQIRDIRSAES


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAEKRVSELAKRYGPKHDKMIQANAQLKSIKLRADKVIKKLVNGIGKELDSAKQQEQLLKKELINKKDEFQSLSVVKREY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DALKREVDTNAKLYDLFLTRQKETSATSDFSASNARFSDYALVPESPSKPNRKMIVVLTVFFSAGFAMALVIIIDAFNNK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISTARDFENKLGLLPTGTIPLVKDKKYRNKAIDYEVFNDKKYNVFHESLDSIRTSLYLNMQTSKRKVIAISSSVPEEGKT
                                                                      SSSVPEEGKT
                                                                             GKT
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASINLAKSFSKLERVLLIDCDLRKPSISRRFDLPQSQMGLANIILMNAPVRDCIVSIPNTKLDVLTAGMIAPNAQELLS
TASINLAKSFSKLERVLLIDCDLRKPSISRRFDLPQSQMGLANIILMNAPVRDCIVSIPNTKLDVLTAGMIAPNAQELLS
                LLIDCDLR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKMFSNLIERLSDKYDRIIIDTPPVLPVKDAFIIGRLTKGIVLIVKSNSTTKSVFKHSMTLFAKHEITLDGVVLNQVVAP
SKMFSNLIERLSDKYDRIIIDTPPVLPVKDAFIIGRLTKGIVLIVKSNSTTKSVFKHSMTLFAKHEITLDGVVLNQVVAP
                 IIIDTPP                                                        
       730       740 
....:....|....:....|.
RKGTHTYSEYANYAYSHESNK
RKGTHTYSEYANYAYSHES  
      YSEYANYAY      

© 1998-2019