BYKdb

Annotate results for A0A0A6RK76

A0A0A6RK76 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A6RK76
DOMAINcd52/249TSSIPNEGKTTFAINQAFALGQMAKTLLIDADMRRPSIAKSLGLNDDAPGLSDLVTGERG
LDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYEYIVIDSAPTIA
VSDALVLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYG
YGYGYGKNYYGYYKSYYG
SITEWalker A59/61GKT
SITEWalker A'78/85LLIDADMR
SITEWalker B162/168IVIDSAP
SITE-159/-187YEYIVIDSAPTIAVSDALVLAKYASGVLY
SITEY Cluster229/248YYGYGYGYGKNYYGYYKSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKLKIGKTDDKMKVMWMFLKEPKSAFAESVRTARTGIMLSNLDIKHKVLIVTSSIPNEGKTTFAINQAFALGQMAKTLLI
                                                   TSSIPNEGKTTFAINQAFALGQMAKTLLI
                                                          GKT                LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRRPSIAKSLGLNDDAPGLSDLVTGERGLDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYE
DADMRRPSIAKSLGLNDDAPGLSDLVTGERGLDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYE
DADMR                                                                           
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIVIDSAPTIAVSDALVLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYGYGYGYGKNY
YIVIDSAPTIAVSDALVLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYGYGYGYGKNY
 IVIDSAP                                                            YYGYGYGYGKNY
       250 
....:....|.
YGYYKSYYGEK
YGYYKSYYG  
YGYYKSYY   
© 1998-2019