BYKdb

Annotate results for A0A0A6S102

A0A0A6S102 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A6S102
DOMAINcd41/233TSVQPAEGKSTTSTNLAISFAKAGFKTLLIDADIRNSVMSGTFKANEKYEGLSSYLSGNA
ELSAVISYTNIPNMMLIPSGQVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADATILVTEAGVIKRRFIQKAKDQMEQSGVQFLGVILNKVEDTIDSYGGYGS
YGSYGDYGKSKRK
SITE-228/-230GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155VIIDTPP
SITE-89/-95YEGLSSY
SITEY Cluster215/227YGGYGSYGSYGDY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVQLELVKSKKNLYDIAEEYYNSIRTNIQFSGRHLKVITLTSVQPAEGKSTTSTNLAISFAKAGFKTLLIDADIRNSVMS
                                        TSVQPAEGKSTTSTNLAISFAKAGFKTLLIDADIRNSVMS
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKANEKYEGLSSYLSGNAELSAVISYTNIPNMMLIPSGQVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
GTFKANEKYEGLSSYLSGNAELSAVISYTNIPNMMLIPSGQVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSAIISQKADATILVTEAGVIKRRFIQKAKDQMEQSGVQFLGVILNKVEDTIDSYGGYGSYGSYGDYGKSKRKKKSSRKK
DSAIISQKADATILVTEAGVIKRRFIQKAKDQMEQSGVQFLGVILNKVEDTIDSYGGYGSYGSYGDYGKSKRK       
                                                      YGGYGSYGSYGDY             
© 1998-2019