BYKdb

Annotate results for A0A0A6VNM8

A0A0A6VNM8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A6VNM8
DOMAINtad1/139MTIDVLGAIKKHVITAIITLVVVAAAVAVYTFTRTPQYTATSELLATYRSSASTTSSTGN
ELNSGASYLNSQIQTYPQLVKTESVLQPVIDDLGLNTTVKTLAASVTASNPTDTMLVDIS
VVDNDPKVASGIANSVAES
DOMAINcd274/462TSAGPSEGKTTISVNLATAFAEAGSKVLLIDADVRSPSVSKKLGIEGTVGLTHLITNTVS
SHDAIQRYWKPNFHVLPAGKQSLNPSILLNSRAMRALVDQVSKAYDYVIIDTDPMQVSND
AAVFAKEGPQLLVVASLGITEKKTLKQTDQELHTLDIQPIGLAINYAEPEKPQKSGYYYY
GEDTDENGK
SITEWalker A281/283GKT
SITEWalker A'301/308LLIDADVR
SITEWalker B381/387VIIDTDP
SITE-378/-380YDY
SITEY Cluster450/453YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIDVLGAIKKHVITAIITLVVVAAAVAVYTFTRTPQYTATSELLATYRSSASTTSSTGNELNSGASYLNSQIQTYPQLV
MTIDVLGAIKKHVITAIITLVVVAAAVAVYTFTRTPQYTATSELLATYRSSASTTSSTGNELNSGASYLNSQIQTYPQLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTESVLQPVIDDLGLNTTVKTLAASVTASNPTDTMLVDISVVDNDPKVASGIANSVAESLKKQVTSTLYTDEGDKIVSPV
KTESVLQPVIDDLGLNTTVKTLAASVTASNPTDTMLVDISVVDNDPKVASGIANSVAES                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLSVVQQAYAPSSPSSPKVVMNLAIGLAAGILLGVAAAIVKDLMDTRIRQDSDATAIMDVPVLGTVTRSDSYTERTPVII


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKPASRDAEEIRRLRTNLTFVLPEEDKANVIVVTSAGPSEGKTTISVNLATAFAEAGSKVLLIDADVRSPSVSKKLGIEG
                                 TSAGPSEGKTTISVNLATAFAEAGSKVLLIDADVRSPSVSKKLGIEG
                                        GKT                 LLIDADVR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVGLTHLITNTVSSHDAIQRYWKPNFHVLPAGKQSLNPSILLNSRAMRALVDQVSKAYDYVIIDTDPMQVSNDAAVFAKE
TVGLTHLITNTVSSHDAIQRYWKPNFHVLPAGKQSLNPSILLNSRAMRALVDQVSKAYDYVIIDTDPMQVSNDAAVFAKE
                                                            VIIDTDP             
       410       420       430       440       450       460       470      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
GPQLLVVASLGITEKKTLKQTDQELHTLDIQPIGLAINYAEPEKPQKSGYYYYGEDTDENGKKRQSQHKKSGKAKD
GPQLLVVASLGITEKKTLKQTDQELHTLDIQPIGLAINYAEPEKPQKSGYYYYGEDTDENGK              
                                                 YYYY                       
© 1998-2019